SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150391482|ref|YP_001321531.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150391482|ref|YP_001321531.1|
Domain Number 1 Region: 32-249
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.18e-49
Family Phosphate binding protein-like 0.0015
Further Details:      
 
Domain Number 2 Region: 637-796
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.47e-37
Family HD domain 0.042
Further Details:      
 
Domain Number 3 Region: 471-611
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.63e-37
Family GGDEF domain 0.00024
Further Details:      
 
Domain Number 4 Region: 328-426
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000108
Family Heme-binding PAS domain 0.056
Further Details:      
 
Weak hits

Sequence:  gi|150391482|ref|YP_001321531.1|
Domain Number - Region: 285-349
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0118
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150391482|ref|YP_001321531.1|
Sequence length 804
Comment diguanylate cyclase and metal dependent phosphohydrolase [Alkaliphilus metalliredigens QYMF]
Sequence
MPVKKLILLIITALLLGSMVTYASPDKPSTAIIFGDDIDYPPFSFLDESGYPTGFNVELG
KAVAEVMGLDVEFQLGNWHEIMQQLENNEIDAISGMFHSVDREAEYAFTARHAVASGDIF
TRDDFSVTSLEDLAGTRVVVQTNDIVHESLVQEDLNIEFIEVSTVAEALRHVSSGEYDYA
AVLKLPAHYIIQHNKLTNLKSNGLSLAPQNYSMAVHKSNGQLLSDLNEGLVILKNTGQYQ
EIYDQWLGVYEERDFLEALRRHYWLFASLLTLLFILLFWTFTLKKIVASRTKELLTTNTK
LNESKKEITSTNQELEALLEELTATEEDLRENYDHLKESEEKYRTLVTQMHQGLALHQII
TNELGEPVDYTFIDVNDSFERLTGLKRDDILGKTVLEVLPDTETYWIERYGQVALTGEPI
HYENYSKEIDRYFEVVAYQPNYNQFAVVLTDVSERKKMADELVYLSYHDQLTGLYNRRFF
EEELKRLDVPRNLPLSIMMADVNGLKLTNDAFGHVVGDKLLQKVATVLKNTCRADDIVAR
LGGDEFVILLPKTDSQEAENLANRIIALIAMEKVQSIDLSVSFGWETKYRDDEEMQEIFR
LAEDYMYKKKLYEGPSNRNKTIGIIINTLHEKNNREEQHSHRVSELCSELGKALRLSESK
IQELKILGLLHDIGKIAINESILNKPGKLTDDEWKEIQRHPEIGYRILSSVNDMSEMAEF
VLAHHERWDGNGYPKGLRENEIPLQARIITVVDAYDAMTSVRSYKKPLSRDEALQELHKH
SGTQFDPDLVIVFSKMLLDQKTDL
Download sequence
Identical sequences A6TUK4
WP_012064832.1.32322 gi|150391482|ref|YP_001321531.1| 293826.Amet_3753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]