SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150391601|ref|YP_001321650.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150391601|ref|YP_001321650.1|
Domain Number 1 Region: 32-268
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.76e-77
Family Phosphate binding protein-like 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150391601|ref|YP_001321650.1|
Sequence length 268
Comment YaeC family lipoprotein [Alkaliphilus metalliredigens QYMF]
Sequence
MKKIILISITIVLLALIVTGCGAKTAAGNEDTLKIGVTGGPHEEIAKKVKELAEDKGLNI
ELVVFNEYIQPNIQLFDKELDANIFQHEPYLIKFNTDRSMDLITIAPTVNFPMGIYSDKI
ASPSELVEGQQVAVPNDSTNQARALILLETAGVIKLREGAGTAVTVRDIVENPKNIKIVE
LEAPMLIRALPDVAVAVINTNFIIEAGMNPVEDSIFIEDKNSPWVNHIVTRPELEEDVRI
KKLVEIYHSSEIRQFIEESFGGAVVSAF
Download sequence
Identical sequences A6TUX3
gi|150391601|ref|YP_001321650.1| 293826.Amet_3892 WP_012064946.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]