SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150391877|ref|YP_001321926.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150391877|ref|YP_001321926.1|
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.93e-36
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150391877|ref|YP_001321926.1|
Sequence length 107
Comment PTS system lactose/cellobiose-specific transporter subunit IIA [Alkaliphilus metalliredigens QYMF]
Sequence
MTNEEVIFQIILHAGNARGEAYDALKAAKEKDFEKAQKHLEEAEKEAGIAHRAQTEIIQG
EINGKKVEMSLLFVHAQDHLMTAIAEKGLIENMMDLYKRVDQLEENK
Download sequence
Identical sequences A6TVP9
gi|150391877|ref|YP_001321926.1| WP_012065215.1.32322 293826.Amet_4186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]