SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150392114|ref|YP_001322163.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150392114|ref|YP_001322163.1|
Domain Number 1 Region: 89-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.71e-31
Family Phosphate binding protein-like 0.0013
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.61e-23
Family LysR-like transcriptional regulators 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150392114|ref|YP_001322163.1|
Sequence length 305
Comment LysR family transcriptional regulator [Alkaliphilus metalliredigens QYMF]
Sequence
MDIRQLRYFIAVAEHLNFTEAAKHLFVAQSAVSQQIADLENKIEVKLFDRNKRSVKLTHA
GGVLLKEAIDIVSRAEEAVIKTQEAELGIIGSLKIGFLGYTEKNFLPFLIRGFRRNYQNI
DLQLDQYNHGILIDSLSTGELDIGFTLSFGLDNIGGLEKRSLFTEPISIVMHCDHPLAHQ
SSINLGDLAQERFIALNRHESPQGFNQTLLICANKGFSPNIVSGPKLLHTVLLLVDAEMG
IAILPKSLEHHASPSLRFIDIEGEAVQHELVVAWKTSNQNPSIPLFLKELDAMNMKGQDD
FLKIT
Download sequence
Identical sequences A6TWD6
293826.Amet_4432 gi|150392114|ref|YP_001322163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]