SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150392386|ref|YP_001322435.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150392386|ref|YP_001322435.1|
Domain Number 1 Region: 91-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-29
Family Phosphate binding protein-like 0.0034
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.76e-21
Family LysR-like transcriptional regulators 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150392386|ref|YP_001322435.1|
Sequence length 296
Comment LysR family transcriptional regulator [Alkaliphilus metalliredigens QYMF]
Sequence
MNLQYLKAFYVTVKLNSISKAAKELHLTQPGLSMQIQSLEKELDVTLLSRSNKGVELTEA
GMVVFDYANTILSMQGNIERDLENLKTSKKDLIIGCCKAVGEYALPCSIYVYKQDHQDVS
ITYDVTNSETVMENLSDRTVNIGLIHSSMKRKNIKTEKITSDRLILSTSLPMLKNKITLE
ELNRLPLIFREEGSGTRETIKQHLSPSGIKVQDLNIIYQLNSMEAIKTSVISGKGISFIP
ALTIQKELRDGVLHEIEIEGLDIYSDFYIAYREDHQFTAYESQFIDFIKSSKKGFC
Download sequence
Identical sequences A6TX58
WP_012065661.1.32322 293826.Amet_4708 gi|150392386|ref|YP_001322435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]