SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150388439|ref|YP_001318488.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150388439|ref|YP_001318488.1|
Domain Number 1 Region: 469-618
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-24
Family Histidine kinase 0.017
Further Details:      
 
Domain Number 2 Region: 36-259
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.36e-18
Family Phosphate binding protein-like 0.013
Further Details:      
 
Domain Number 3 Region: 393-466
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000011
Family Homodimeric domain of signal transducing histidine kinase 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150388439|ref|YP_001318488.1|
Sequence length 627
Comment integral membrane sensor signal transduction histidine kinase [Alkaliphilus metalliredigens QYMF]
Sequence
MNKNKTYIVVIIIMILYIFPIDRVQGLDEAVLQLRWDHQFQFAGYYTALWNGYYEEEGLE
VEIRSAFTEEGDVLQATQEVAEGDADFGVGAVDILIANDEGLDLAVLASIFQRSAVEFFM
KEETPFSTMADLVNLQVARRKDDLMDIELQAMLMAEGIDPKQLKLYEHRGNFAIEDLGDD
GFDMVPIYLRNILTYPEEEGVQLKSIRPIDYGIDFYGDSLFTRGSLAKENPDKVEAFKRA
SLKGWEYALENPEEIIEKMVVAFPPQEKTEKEFRAFNVFQAREVLELTLHPVVEIGNINP
HRWWGTQEVLKKLNLVSGDLDRENFIFSYDRILQQQAERKEKFLQIFSLISVVILLIVLI
IYLTAKSTIRKLEKMFQREWEENKRKEGIIIYQARLAAMGEMIANIAHQWRQPLNNLGLI
LNNIEDAYHYEELTKKSLEEDIERSRRLIHKMSETIDDFRNFSNPNTKKDEFSIHENIMM
VLDLMEERIKLHHIEVVFKDISTKKAYGYSNQFAQGIFNVISNSIDALIDEKGGKRQIFI
GIYEQGNDVITEIEDTGGGISEAIADKVFDLYFTTKEDTQGTGLGLYMTKVIIEKNLKGS
LHWKNTDRGVKMMIRIPCKGVDGNVTD
Download sequence
Identical sequences A6TKW1
gi|150388439|ref|YP_001318488.1| 293826.Amet_0602 WP_011971737.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]