SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134045303|ref|YP_001096789.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134045303|ref|YP_001096789.1|
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-40
Family GHMP Kinase, N-terminal domain 0.0000079
Further Details:      
 
Domain Number 2 Region: 191-313
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.4e-24
Family Mevalonate kinase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134045303|ref|YP_001096789.1|
Sequence length 317
Comment mevalonate kinase [Methanococcus maripaludis C5]
Sequence
MKKIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENSDTISIDLVDLNEIFEITPE
LIKNLEISNFSPALKYVICAVKSVIFYLSEFKDLKEIKPFKLKLYSEIPLSCGLGSSASV
VVTVIRSISNFYGIELDNDETINLAYSVEKEVQGRASVTDTATISLGGMIEIINGEYKPM
PKDLEEFIKTCKFLVVNVEERTRKTAELVHDVSKHPEKEQIFEEIGNIIQKVRQVTEKAE
LGKLMNENHELLRKFGISTEKLDLVAKAGQKYGYGGKLTGAGGGGSAIILLKEDQNELLN
ELKKIGVIGIYECKMAN
Download sequence
Identical sequences A4FWJ9
WP_011868031.1.72418 gi|134045303|ref|YP_001096789.1| 402880.MmarC5_0258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]