SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134045565|ref|YP_001097051.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134045565|ref|YP_001097051.1|
Domain Number 1 Region: 94-220
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 6.28e-22
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 14-91
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134045565|ref|YP_001097051.1|
Sequence length 494
Comment succinate dehydrogenase/fumarate reductase iron-sulfur subunit [Methanococcus maripaludis C5]
Sequence
MKTFTITVKKTEGFKKFEVPVGITVLSALEYINKTYGENIQFRSSCRAGQCGSCAMMINK
KSKLACKTKVEDNAIIEPLDGFDVISDLVVNREPYYKKIGTLRNYIQKKTEKITEEDLDK
LKLYPDDLKDVKKIRGCIDCLSCIAMCPARKYSDYPGPTLMRQLARFAFDPKDELDREKE
AFDENIYNCTTCGRCVEVCPKEIDIVHNAVEKLREKTFKKGYNLDSHLEVRKNVLSQNRS
IPKEKTSFLEEVAEEYLVKNEKMRVAFFTGCLIDFRLQEIGKSAIRVLNAHGVSVIIPKN
QVCCGSPFIRTGQTDISDKLKKQNLEIFNKLNVDSVVTLCAGCGSTLKNDYTEKEFKVMD
ITEVLVKVGLLDYKPLDITVTYHDPCHLRRGQKVYLEPRKILESIPKLKFVEMEIPDQCC
GAGGGVRSGKPEVADTIGKRKANMIYATDADYLITVCPFCEYHIRDSLKKYFEEHGLKKD
IPVMNIVSLLDKVI
Download sequence
Identical sequences A4FXA7
gi|134045565|ref|YP_001097051.1| 402880.MmarC5_0522 WP_011868291.1.72418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]