SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134046128|ref|YP_001097614.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134046128|ref|YP_001097614.1|
Domain Number 1 Region: 67-200
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.46e-25
Family Ribonuclease H 0.003
Further Details:      
 
Domain Number 2 Region: 3-47
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.000000000000262
Family N-terminal domain of RNase HI 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134046128|ref|YP_001097614.1|
Sequence length 201
Comment ribonuclease H [Methanococcus maripaludis C5]
Sequence
MAKIYAVRKGRKTGLFETWAECETQVKGFSGAEFKSFTSKKDANDYLTQKTGQKQNNIKS
DEFKKDIMYAWVDGSFNLRNNEYGAGALIIFNGMEKEIKSKGNDEELSKMRNVAGEILAS
ELAMEYAVSKNVKNLVIYHDYLGIEKWCTGKWKTNKAGTIEYKEKCKNYLKRLNIEFLKV
KAHSEDKNNEIADKLAKEALL
Download sequence
Identical sequences A4FYW5
WP_011868852.1.72418 402880.MmarC5_1097 gi|134046128|ref|YP_001097614.1| NYSGRC-FDAO-134046128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]