SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134046275|ref|YP_001097760.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134046275|ref|YP_001097760.1|
Domain Number 1 Region: 47-211
Classification Level Classification E-value
Superfamily ITPase-like 3.92e-50
Family YjjX-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134046275|ref|YP_001097760.1|
Sequence length 219
Comment hypothetical protein MmarC5_1248 [Methanococcus maripaludis C5]
Sequence
MFESRFCDICGKPAKTYRFGSLLCDNPECLEEAQKLRGGPAGHKLRVVSVGSTNPVKVSA
VEKAIAKTVGNMLVTPSDVESGVPNQPNGFEETFKGAYNRAKGAFEKVNSVYGIGIEAGM
VEIGEKKLDIHICVVYNGLDYSVGTSQGFQIPKEISDKIDEGFECGSVTEETYGIKNIGQ
KNGLIGVLSDDNILREELCINSVIMAMIPKFKRNSEIRF
Download sequence
Identical sequences A4FZB2
402880.MmarC5_1248 gi|134046275|ref|YP_001097760.1| WP_011868999.1.72418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]