SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119896723|ref|YP_931936.1| from Azoarcus sp. BH72

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119896723|ref|YP_931936.1|
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.98e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 407-549
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.02e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.76e-34
Family Duplicated SiR/NiR-like domains 1 and 3 0.024
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119896723|ref|YP_931936.1|
Sequence length 560
Comment putative sulfite reductase [Azoarcus sp. BH72]
Sequence
MYRYDDYDQRLVDERVAQFRDQTRRYLAGELSEDEFRPLRLQNGLYVQRHAPMLRIAVPY
GLFSSAQLRTLADIARRYDRGYGHFTTRQNIQFNWPELAKVPEILAQLATVQMHAIQTSG
NCIRNITSDAFAGVAADELIDPRPWCEILRQWSSFHPEFAHLPRKFKFAVNGAKEDRAVI
QAHDIGLDVVKNDAGEIGFRVLVGGGLGRTPIIGEEIAAFVPWQHIVTYCESILRVYNLH
GRRDNKYKARIKILVKALGIEEFRRQVEAEWAFHKNGPSTLTEAEVARVAAHFVDPAYES
LPATDAGYASLLDENKPFAAWVKRNVRAHKVPGYASVTISLKKTGVPPGDITESQMELVA
DLADAYSYGEVRATHQQNLVLADVRQSDLFKVWQSLRDAGLATPNIGLLTDIISCPGGDY
CALANAKSIPIANAIQERFDNLDYLYDIGEIELNISGCMNACGHHHVGHIGVLGVDKNGE
EWYQVTIGGDQGNKAAIGKVIGPSFAAAEMPDVVTHLIETYIANRHEDERFVDTVRRIGI
EPFKAHVYGNRQTEKKVAHA
Download sequence
Identical sequences A1K2J4
62928.azo0432 gi|119896723|ref|YP_931936.1| WP_011764167.1.91620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]