SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119897466|ref|YP_932679.1| from Azoarcus sp. BH72

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119897466|ref|YP_932679.1|
Domain Number 1 Region: 629-803
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.19e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 1-188
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.97e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0035
Further Details:      
 
Domain Number 3 Region: 145-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.34e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0063
Further Details:      
 
Domain Number 4 Region: 498-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.05e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 
Weak hits

Sequence:  gi|119897466|ref|YP_932679.1|
Domain Number - Region: 345-384
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0618
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119897466|ref|YP_932679.1|
Sequence length 843
Comment nitrite reductase (NAD(P)H) large subunit [Azoarcus sp. BH72]
Sequence
MKIVLVGHGMVGHKFLEELQQLQIPGAEVTVLCEEPRTAYDRVHLSEFFSGKTAEDLSLV
APGFFDDTGFALRLNSRAAAIDRRAKTVTTQDGVTLSYDKLVLATGSYPFVPPVKGNDRE
QCFVYRTIEDLEAMKAAGAISRKGVVVGGGLLGLECAKALRDLGLETHVVEFAPRLMAVQ
VDDDGGRILREKIEQLGVQVHTSRNTTEITDGMTARHRMVFADGSHLETDMIVFSAGIRP
RDELARQNALAVGARGGIAVDDHCRTSDPDIYAIGECAAWRDQTFGLVAPGYDMARLVAR
HLAGETKAAFAGADMSTKLKLMGVDVASIGDAHGKTAGCRSFRYSDEVKQVYKKIVVSED
GKRLLGAVLVGNADEYGTLLQMALNGIAPPAEPEFLILPSSDGKAKPGLGPDALPDSAQI
CSCNNVSKGQICAAVGEGATSIGEIKSCTKAGATCGGCVPLVTQIMKAEMAKRGMAVNNH
LCEHFPYSRQELFHLVRVGGIKSFEDLLARHGQGHGCDICKPTAASIFASCWNDFVLQGE
LASLQDSNDYFLGNIQKDGTYSVVPRMPGGEVTPDGLIAVGQVAKKYGLYTKVTGGQRVD
LFGARVEQLPAIWEELIAAGFESGHAYGKALRTVKSCVGSTWCRYGVDDSVGLAVELENR
YKGLRAPHKIKFGVSGCTRECAEAQGKDVGIIATERGWNLYVCGNGGMKPRHAELIASDL
DRAALIRLIDRFLMFYVRTADRLQRTSTWRENLEGGLDYLKDVLIADSLGLAAELEAQMQ
HVVDTYQCEWKTAVTDPDVRKRFRTFVNDPQADKRIVFVKERGQIRPARAEERDAATADP
LAV
Download sequence
Identical sequences A1K4N7
62928.azo1175 gi|119897466|ref|YP_932679.1| WP_011764908.1.91620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]