SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119898293|ref|YP_933506.1| from Azoarcus sp. BH72

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119898293|ref|YP_933506.1|
Domain Number 1 Region: 222-355
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 8.63e-33
Family Cell-division protein ZipA, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119898293|ref|YP_933506.1|
Sequence length 373
Comment hypothetical protein azo2002 [Azoarcus sp. BH72]
Sequence
MDSELQVALIGAGAALVVLIVAYNKWQERKHRRRAEQAFKSDHRDVLLEPDGADATDGAR
VEPSFDSDGGDNEPVIGTPAAAPRPVREAATRRSVPEKPAELDTRADCVILIEAIEPLDV
PRLWAAQQQQLDGLSKPVRWFGFDDGGNVWRPLNTHSAGAYHWFCAAMQLVDRNGPIGET
DFMRFSGGVQRIAEQFFAVPAGLPARVQALGGATELDRFCADVDVQIGINVVATQQPFLG
TKLRGLAEAEGLALADDGSFHMRDEAGNTVFTLSNLEPTLFTAENLRTVQTHGITLVIDV
PRVANGAACFERMMQLATHLAGALQGVVVDDNRAPFGVDAAGMIRSQIAQFQDRMASHDI
PAGGPLALRLFAA
Download sequence
Identical sequences A1K714
WP_011765733.1.91620 gi|119898293|ref|YP_933506.1| 62928.azo2002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]