SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150002977|ref|YP_001297721.1| from Bacteroides vulgatus ATCC 8482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150002977|ref|YP_001297721.1|
Domain Number 1 Region: 392-556
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-43
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 596-716
Classification Level Classification E-value
Superfamily CheY-like 6.69e-29
Family CheY-related 0.0079
Further Details:      
 
Domain Number 3 Region: 321-403
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000124
Family Homodimeric domain of signal transducing histidine kinase 0.0042
Further Details:      
 
Domain Number 4 Region: 695-707,740-836
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.000000000000124
Family Phosphorelay protein-like 0.046
Further Details:      
 
Weak hits

Sequence:  gi|150002977|ref|YP_001297721.1|
Domain Number - Region: 107-288,316-364
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00968
Family DNA repair protein MutS, domain III 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150002977|ref|YP_001297721.1|
Sequence length 855
Comment two-component hybrid sensor kinase/response regulator [Bacteroides vulgatus ATCC 8482]
Sequence
MSLPNRSTKLKVAFGYILLTALLFISIGYIYQEMKSLSGTGDDEAILSQRRHVTNQIIGQ
LYQAEVIGQSLSTGQIEQYYRYQRAMKQATTALDSLRTLLTDSIQLARLDTVGMLFMDKE
RNMRNLLKAIQDGGTDILYKQHIDELIAQQDSLLSLPHVRKKVITHTNSYIIRKKPKSFF
KRLGEVFSPGKADSTQVNNVIQEEYTDTLTEAYSPADTVVTMLKNIQSRVTDTQQERMEM
VNRRTQSLRLSGLKLSQKVNQLLSTIEEEEQALAQNKHIQEEYIRQSSIRTVAGIAIVAV
VLAIFFLVLIWRDITRSNHYRRELEKAKRRAEDLLAAREKLMLTITHDIKAPVGSILGYT
DLLERITTEERQRFYLNNMQSSANHLLSLVKSLLDYHRLDAHKMDVNQVSFNPHQLFDTI
YISFKPMADSKQLELNYHCNESLNRVYIGDPFRIRQIAENLLSNALKFTKEGGITLRAAL
ENGQLHFSISDTGCGISQEEQQRIFQEFTRLHNAQGQEGFGLGLAITRKLVLLLEGDIKI
ESEQDKGSCFHVYLPLPEGPSHPDENLSGPGAEHTPASPDATGIRQTDTPREDSEPIHLI
LIDDDRIQLQLTTAMLERPGVTVTCCHHPEELLNQLKEKRFDVLLTDIQMPAMNGFDLLK
AIRTLDTSWVQTLPVIALTARSDMDENYFCSHGFAGCLHKPFTINELFTAIFQVTGKDVP
ATGNPTPHIAPAKENHPQQETLDFSALTAFSEDDPEAASEILRTFISETKKNRECMEEAL
AKKNMEDITAIAHKLLPLFTMLGATRCIPALTWMEQRRGTTEIGEEAIEKTNFIIEEIEK
VIDEAKKQIEIPNEA
Download sequence
Identical sequences A0A078QYN1 A0A174K803 A6KXD5 C6Z762 E5UV49
WP_008667667.1.15823 WP_008667667.1.15915 WP_008667667.1.34002 WP_008667667.1.56832 WP_008667667.1.6673 WP_008667667.1.8648 WP_008667667.1.97168 435590.BVU_0380 gi|150002977|ref|YP_001297721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]