SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150003358|ref|YP_001298102.1| from Bacteroides vulgatus ATCC 8482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150003358|ref|YP_001298102.1|
Domain Number 1 Region: 382-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.67e-29
Family ABC transporter ATPase domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 125-220,271-378
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000157
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150003358|ref|YP_001298102.1|
Sequence length 599
Comment DNA mismatch repair protein MutS [Bacteroides vulgatus ATCC 8482]
Sequence
MELKAKYEQRIEQAEAELRQIKNKILRISTLRVLLFAAGIIGTIYFYQAGTPTICLTIAV
TFVPFLALVKYHNRLFFRKDWLETCIRVNSDELSALADNYEPFEDGKEFTNPAHRYSFDL
DLFGRHSLFQALNRTCTSFGKEKLAEWLQNHLEIKEEIIQRQEATKELAAYSDFRETFRI
TGLLYKGATSDREEIKEWTEAPAYFSKKWWSRPLLGIVPGVNIVLAMLGVAGVIPMTWFG
LAFGLFVIGSFGLIKPVSNLQRVYDKKLRILSIYAELISLIENREMNAPLLRHLKAEFGM
NGKSTTHILKELSRELDKLDLRNNQLLYVLLEGSMFWQLRQVMRIEQWRHKYGKYLLHWL
DVLGDIDALCSLATFAGNHPAYTYPTIAGKPFVFLAKDMGHPLMPARQCVTNDADIPSRP
FFVIITGANMAGKSTYLRTIGVNYVLACTGCPVCCSSLEIYPAKLVTSLRTSDSLTDNES
YFFAELKRLKQIIDRLNKGEELFIILDEILKGTNSMDKQKGSFALVRQLMELKTNGIIAT
HDLLLGKLIEYFPKEIRNYCFEADITNDELTFSYKLREGIAQNMNACFLMKKMGLIIND
Download sequence
Identical sequences A0A1Q6J8T8 A6KYG6 R7P1I0
WP_011964904.1.15823 435590.BVU_0776 gi|150003358|ref|YP_001298102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]