SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150003763|ref|YP_001298507.1| from Bacteroides vulgatus ATCC 8482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150003763|ref|YP_001298507.1|
Domain Number 1 Region: 268-566
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-81
Family DNA repair protein MutS, domain III 0.00000152
Further Details:      
 
Domain Number 2 Region: 567-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-57
Family ABC transporter ATPase domain-like 0.00000107
Further Details:      
 
Domain Number 3 Region: 7-113
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.71e-39
Family DNA repair protein MutS, domain I 0.0000469
Further Details:      
 
Domain Number 4 Region: 114-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 8.37e-37
Family DNA repair protein MutS, domain II 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150003763|ref|YP_001298507.1|
Sequence length 870
Comment DNA mismatch repair protein MutS [Bacteroides vulgatus ATCC 8482]
Sequence
MANDVVLTPMMKQFFELKAKHPDAIMLFRCGDFYETYSEDAIVASEILGITLTKRANGQA
KSVEMAGFPFHALDTYLPKLVRAGKRVAICDQLEDPKMTKKLVKRGITELVTPGVAINDN
VLSYKENNFLAAVHFGKASCGVAFLDISTGEFLTAEGPFDYIDKLLNNFAPKEVLFERGK
RGMFEGNFGSKFFTFELDDWVFNESSSREKLLKHFETKNLKGFGVEHLKNGIVASGAILQ
YLNMTQHYQIGHITSLSRIEEDRYVRLDKFTVRSLELIGSMNEGGTSLLDVIDRTISPMG
ARLLKRWVVFPLKDEKPVNERLDVVEYFFREPDFKEFIEEKLHLIGDLERIVSKAAVGRI
SPREVVQLKVALQAIEPIKNACLNADNGSLRRIGEQLNLCLSIREKIAKEVKNDPPLLVN
KGGVIADGVNAELDELRQIAFSGKDYLLKVQQRESELTGIPSLKIAYNNVFGYYIEVRNT
HKDKVPADWIRKQTLVNAERYITQELKEYEEKILGAEDKILVLETKLYNELVVALAEFIP
AIQINASQIARLDCLLAFANVAKENNYIRPVVEDSEVIDIRQGRHPVIEKQLPVGEKYIA
NDVFLDSETQQIIIITGPNMAGKSALLRQTALITLLAQMGSFVPAESARIGMVDKIFTRV
GASDNISVGESTFMVEMNEAANILNNLSSRSLVLFDELGRGTSTYDGISIAWAIVEHIHE
HPKAKARTLFATHYHELNEMEKSFKRIKNYNVSVKEIDNKVIFLRKLERGGSEHSFGIHV
AKMAGMPKSIVKRANDILHQLETDNRQQGIAKPTAEIASGRSGMQLSFFQLDDPVLSQIR
DEILNLDVNNLTPLEALNKLNDIKKIVKGK
Download sequence
Identical sequences A0A078RGU3 A0A1Q6JA35 A6KZM1 E5UNS0 I9UB44
BvR148 435590.BVU_1195 WP_005849895.1.15823 WP_005849895.1.15915 WP_005849895.1.25291 WP_005849895.1.34002 WP_005849895.1.56832 WP_005849895.1.8648 WP_005849895.1.97168 gi|150003763|ref|YP_001298507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]