SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150004986|ref|YP_001299730.1| from Bacteroides vulgatus ATCC 8482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150004986|ref|YP_001299730.1|
Domain Number 1 Region: 303-528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-37
Family ABC transporter ATPase domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 24-299
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 7.32e-19
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 761-835
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000196
Family Smr domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|150004986|ref|YP_001299730.1|
Domain Number - Region: 554-637
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0549
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150004986|ref|YP_001299730.1|
Sequence length 836
Comment DNA mismatch repair protein MutS [Bacteroides vulgatus ATCC 8482]
Sequence
MIYPQNFEQKIGFDSIRHLLKEKCLSTLGQERVDEMNFSESFKDINEWLEQVMEFMRIIQ
EEDSFPDQYFFDVRPSLKRIRVEGMYLDEQELFDLRRSLETIRDIIHFLTLTSNDEEQEK
ENSPYPALQKLAGDIIVFPQLITRINNILDKFGKIKDNASSELLRIRRELASTAGSISRS
LNAILRNAQAEGYVDKDVTPTMRDGRLVIPVAPGLKRKIKGIVHDESSTGKTVFIEPAEV
VEANNRIRELEGEERREIIRILTDFSIIIRPQVPAILQSYEFLAEIDFIRAKAHFSIQTN
ATKPSLEDKQILDWTMAIHPLLQLSLAKHNKKVVPLDIELTKNQRILIISGPNAGGKSVC
LKTVGLLQYMLQCGMPVPMHERSHAGLFGSIFIDIGDEQSIEDDLSTYSSHLTNMKTMMK
SCNERSLILIDEFGGGTEPQIGGAIAEAVLKRFNEKGTFGVITTHYQNLKHFAEDHEGVV
NGAMLYDRHLMQALFQLQIGNPGSSFAVEIARKIGLPEEVIADASEIVGSEYINADKYLQ
DIVRDKRYWETKRQNIRKREKQMEETIAKYEEELQELEKSRKEILRKAKEDAEKLIQESN
ARIENTIRIIKEAQADKERTQSARQELTDFKNQIEDIEKKNKEDEIIRKMEKLREKQERK
KNKKDKAKTESSQLSMPKEQPITVGSTVKIKGQSSVGEVLGINGKNAIVMFGMIKTNVKL
DKLERSTPIQPTQKTMVKSTFVSSETQDRVYEKKLNFKQDIDVRGMRGDEAIQAVTYFID
DAILLGIDRVRILHGTGTGILRTLIRSYLGSVPGVAHYQDEHVQFGGAGITVVDLK
Download sequence
Identical sequences A0A174MHM0 A6L344 D4V758
435590.BVU_2450 WP_005841795.1.102092 WP_005841795.1.15823 WP_005841795.1.47352 WP_005841795.1.6673 gi|150004986|ref|YP_001299730.1| BvR94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]