SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150004225|ref|YP_001298969.1| from Bacteroides vulgatus ATCC 8482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150004225|ref|YP_001298969.1|
Domain Number 1 Region: 26-300
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.07e-62
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 451-623
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-42
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 3 Region: 656-784
Classification Level Classification E-value
Superfamily CheY-like 2.42e-35
Family CheY-related 0.00034
Further Details:      
 
Domain Number 4 Region: 383-463
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.46e-16
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 
Domain Number 5 Region: 858-906
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000148
Family AraC type transcriptional activator 0.012
Further Details:      
 
Weak hits

Sequence:  gi|150004225|ref|YP_001298969.1|
Domain Number - Region: 805-852
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0188
Family AraC type transcriptional activator 0.045
Further Details:      
 
Domain Number - Region: 306-391
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0207
Family HBL-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150004225|ref|YP_001298969.1|
Sequence length 908
Comment two-component system sensor histidine kinase/response regulator, hybrid [Bacteroides vulgatus ATCC 8482]
Sequence
MKKHLLFLILCLMGILTSCSQKHTRYYIGVSQCSDDEWRHKMNHEIVREALFYDGVEVEI
RTAKDNSRNQIEDINYFIDRKVDLLIVAPNEAAAVTPVVEKAYGLGIPVVVIDRKILSDR
YTAFVGADNCEIGKDVGQYIVNRLGGKGKILEITGLEGSTPAMERHRGLADALKAEPGIE
ITASVDGAWLQSVAGEKMDSILQDNKGINLVFAQNDRMAVGAYLSARQRQLEKEMLFVGI
DALPGKGYGVEQVLEGVLDATFIYPTGGDKVMQVAMDILEKRPYERDTKLSTALVDKTNA
RVMQLQTDHIAEQDGKIERLNNQVDEYWSRYSAQTMFLYACLIILLLFAALLAIIVRAYW
TKNRMNMELSRQKKQLEEQRDQLISLSKQLEEATHAKLVFFTNVSHDFRTPLTLVADPVE
QLLEDKDLTSKQRSLLKVVHKNVNILLRLVNQILDFRKYENGKLELVRTNMDLRAQLQEW
SHAFQTLALRKHIHFVLDVNDDRTDCLMALDAEKMERVYFNLLSNAFKFTPENGTITVTL
STLIKEENRRYVRLVVADTGSGISVRHIRHIFDRFYQMDVNHAGSGIGLALAKAFVELHG
GVITVDSVEGKGTVFTVDIPMEIVEGQSVDRIQEPHTTQPTVVEELEETETEERLPDENK
ECILIIDDNADVRGYVKSLLKEEYTVIEAADGHAGLKKAMKYVPDAIICDVMMPVMDGLE
CCRKLKMELQTSHIPVMLLTACSLDEQRIQGFECGADSYISKPFNSKLLLVRLRNLIDNH
KRLKQFFGDKITLSKESVSEVDKGFVERFRELIEANLTDSELSVEELGSKMGLSRVQLYR
KIKALTNYSPNELVRIARLKKAASLLASSEKTISEITYEVGFTSPSYFTKCYKEYFGESP
TDFLKRRG
Download sequence
Identical sequences A6L0Y3
WP_011965253.1.15823 gi|150004225|ref|YP_001298969.1| 435590.BVU_1666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]