SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145588276|ref|YP_001154873.1| from Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145588276|ref|YP_001154873.1|
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.23e-28
Family Frataxin-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145588276|ref|YP_001154873.1|
Sequence length 126
Comment frataxin family protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
Sequence
MNPNNSAVETIDDKQFYQLGSNLLHSIEVALESADDELDLDLDVERQGGNVINIRFRDKS
VIVVNTQPPLHEIWVAAKSGGYHYRWAGTLAQPLWLDTKTGKELLSDLSEFASTQAGQPI
KIELMK
Download sequence
Identical sequences A4SUZ5
312153.Pnuc_0087 WP_011901934.1.22821 WP_011901934.1.27397 WP_011901934.1.31131 WP_011901934.1.54276 WP_011901934.1.58031 WP_011901934.1.63010 WP_011901934.1.78143 gi|145588276|ref|YP_001154873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]