SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145589048|ref|YP_001155645.1| from Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145589048|ref|YP_001155645.1|
Domain Number 1 Region: 1-115,154-242
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.65e-25
Family ADPRibase-Mn-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145589048|ref|YP_001155645.1|
Sequence length 255
Comment metallophosphoesterase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
Sequence
MKLHVLSDLHLEFADFTPVSNTADVIVLAGDIGLRAEGVTWARKSFPDQEIIYVAGNHEF
YGSQRSHVIEDIQNTCAENGIHFLDDDGIELHDPQSNTPVRFLGATLWTDFLLFGEDLKS
KCLSYGELYLNDFRRIRDGGRNFSPKKSIQLHEKSLAWLQKELENPFDGKTVVVTHHLPS
MISVAQRYKPDLLSACFASELAHLFGKMSLWIHGHTHDSCDYQTNGTRVVCNPRGYVRSN
HAENPAFNPSLIIEI
Download sequence
Identical sequences A4SX67
gi|145589048|ref|YP_001155645.1| 312153.Pnuc_0863 WP_011902706.1.22821 WP_011902706.1.27397 WP_011902706.1.54276 WP_011902706.1.58031 WP_011902706.1.63010 WP_011902706.1.78143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]