SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145589755|ref|YP_001156352.1| from Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145589755|ref|YP_001156352.1|
Domain Number 1 Region: 66-217,255-406
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.35e-70
Family Acetamidase/Formamidase-like 0.0000856
Further Details:      
 
Domain Number 2 Region: 413-490
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 0.000000101
Family Acetamidase/Formamidase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145589755|ref|YP_001156352.1|
Sequence length 498
Comment acetamidase/formamidase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
Sequence
MKYPKLALLGGLIILASPITHAFPDDGYSRPYQPITPAPVFIQGPPDQANMLVRQLSNSK
NNTYILPAIPSTTNWGYFDAGAPPALSIKSGDTVMIETLPAGGGQVAPGITEAQIDSINN
DPMFPGRGPHTLTGPIFVEGAKKGDVVAVHINKIRMRSYATNNSAAKAGLFYDQFPPKVD
TYYLDNEKMEMQFESNIVVPLSPFPGILAVARSKEEQLLPYTTITSFNEKNPPSPQHSGW
CVKMSGSLGGTIGCDSKQPGAYGGNLDLREMTVGSTTYLPVFVDGAYIWTGDSHAAQGNG
EVDLDALETAFSELNVTVTLIKKEDRPEFGVWPIVETPNAWITIGYDLNLNQALSNLKEE
TVRFIQSSRKVTKPEAEAIMLNNWNCPISEVVNEVLGTYCIIPKNINTQKSADIPKEDSA
QFWVSYASDPSDLMAAMKSASMQSIVKMSQNLSITEDRAYRLATFVMDCRIGRPQQGIYE
VSCMVPKSILRNSAKNKS
Download sequence
Identical sequences A4SZ74
gi|145589755|ref|YP_001156352.1| WP_011903411.1.22821 WP_011903411.1.78143 312153.Pnuc_1574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]