SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145590179|ref|YP_001156776.1| from Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145590179|ref|YP_001156776.1|
Domain Number 1 Region: 3-274
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.02e-90
Family Methylenetetrahydrofolate reductase 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145590179|ref|YP_001156776.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
Sequence
MELSVEFFPPKTPEGESKLHLVRERFSETLKPSFYSVTFGAGGSTQSGTLKVVSDIHAAG
AAVAPHLSCVGSSRESVREMLKQYQALGVKRIVALRGDLPSGMGQYGEFHHANELVEFIR
AETGDWFHIDVAAYPETHPQAKSPASDVDFFVQKIKAGANSAVTQYFYNSDAYFRFVDEA
YDLGVTQPIIAGIMPITNCTQLLRFSDTCGAEIPRWIRLRLQSYGDDIASIKAFGEEVVT
DLCDQLLTAGAPGLHFYSLNQADAVLAIADNLDLTK
Download sequence
Identical sequences A0A1J0DEX9 A4T0E8
312153.Pnuc_2001 gi|145590179|ref|YP_001156776.1| WP_011903835.1.1615 WP_011903835.1.22821 WP_011903835.1.27397 WP_011903835.1.31131 WP_011903835.1.54276 WP_011903835.1.58031 WP_011903835.1.63010 WP_011903835.1.78143 WP_011903835.1.78446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]