SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120601785|ref|YP_966185.1| from Desulfovibrio vulgaris subsp. vulgaris DP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120601785|ref|YP_966185.1|
Domain Number 1 Region: 195-597
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.69e-88
Family beta-Lactamase/D-ala carboxypeptidase 0.00021
Further Details:      
 
Domain Number 2 Region: 81-242
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.4e-37
Family Penicillin binding protein dimerisation domain 0.00098
Further Details:      
 
Domain Number 3 Region: 634-687
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000068
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120601785|ref|YP_966185.1|
Sequence length 690
Comment peptidoglycan glycosyltransferase [Desulfovibrio vulgaris DP4]
Sequence
MLRAKTPRKTRNTRQKTSRMGGGLSSRLGNVDWGRLRIKAVAGLFGVIWCLLWMRAWHVQ
VIEGDRLAGMARRQHVAAELVTGQRGSILDRNGQVLARSVEMRSVYVHPLEVQDVDNTAA
VLSRCLDLPLPQVRAALSERRRFAWLARKVDDRKANLVREAKLSGVGLTTEYERIYPFRQ
MAGQLLGFVGLDDKGLEGVERAMDDSLAGTSTRMVMERDAAGRRFYLPGSSDNDIRGGDV
RLTIDMQVQFFAEEALADAVDTYEAKWGGALVVDVQSGDILAWAQYPFFNPNAYKEYTPA
RWRNRLASDALEPGSTFKPFLVAAGLQEGVITPDTLFYCEKGKWKTRTINIRDTHSYDWL
PVNKIMRYSSNIGCAKIGLELGTRRYHDYLVKLGFGERTGVPVAESKGILRKPRDWSEAD
LITASFGQSVSVTALQMAQGYLTLANDGVLKKLRLFIPESGAQQQDVVPSPSPVGPGVAV
AAEPRRIFSHKVARQVMDMLRDVVEEDGTGTRARIAGITIGGKTGTAQKADSSGSYGKGR
LASFVGLVPIDRPRYLIFVMVDEPTRSPYGGVVAAPVFKHVALRTMAYHGLLPEPVDTDD
LKVAEVQKKGAPQDIRQEVRREISERVIETADNVPDVVGKPVRRAVEMFATKGRVPVLKG
TGQTVVKQSPEPGAAWQDDKEYILWLSERS
Download sequence
Identical sequences A0A0H3A5J5
WP_011791800.1.63145 391774.Dvul_0735 gi|120601785|ref|YP_966185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]