SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471260678|ref|YP_007643534.1| from Micavibrio aeruginosavorus EPB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471260678|ref|YP_007643534.1|
Domain Number 1 Region: 201-342
Classification Level Classification E-value
Superfamily CBS-domain pair 1.89e-29
Family CBS-domain pair 0.0021
Further Details:      
 
Domain Number 2 Region: 344-426
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-21
Family CorC/HlyC domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471260678|ref|YP_007643534.1|
Sequence length 433
Comment Hemolysins-related proteins containing CBS domains [Micavibrio aeruginosavorus EPB]
Sequence
MSNEILIIAFLLLLNAFFALSEMAIVSSSKPLLRQYAKQGKKGAQAALDLAENPGRFLST
VQVGITLVGILAGAYGGATIAEKLKEPFNQIELIAPHGETLAVMLVVGLITYFSVVVGEL
VPKQLALNNSEKFAMLVAPLMKWVSKICTPIVLVLELSARFLMIVMRIKPRDEGVTETEI
TAMIAEGVVSGAIEGEEHDVIRRVIRLGDRDVKSIMTHRTDVSFIDVDDSFDDVCRKIAE
AGHSRYPVIDKDKTHVLGFVKAKQMLSGYAKGHDFNVRDYMHDVLFVNENTSCLDVLGLF
RRKSLHIAAVIDEYGTFDGLFTTSDLLEAIVGMMPSNYDHDEGPLIVQREDGSWLVDGLT
PIEEIHMVTGIEDVPADDDYETIAGFVMMHLRGSLAAGMYFEFKGYRFEIVDMDGLRIDK
VLITRTAMPGPEA
Download sequence
Identical sequences M4W0E8
WP_015468428.1.40777 gi|471260678|ref|YP_007643534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]