SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115350159|ref|YP_771998.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115350159|ref|YP_771998.1|
Domain Number 1 Region: 643-1099
Classification Level Classification E-value
Superfamily ALDH-like 2.75e-126
Family ALDH-like 0.000000301
Further Details:      
 
Domain Number 2 Region: 259-608
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.63e-120
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000601
Further Details:      
 
Domain Number 3 Region: 89-258
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 8.89e-65
Family N-terminal domain of bifunctional PutA protein 0.000000397
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000282
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Weak hits

Sequence:  gi|115350159|ref|YP_771998.1|
Domain Number - Region: 1149-1263
Classification Level Classification E-value
Superfamily ALDH-like 0.00327
Family ALDH-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|115350159|ref|YP_771998.1|
Sequence length 1310
Comment multifunctional functional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia ambifaria AMMD]
Sequence
MASTTLGVKVDDLLRSRLKDAAARLERTPHWLIKQAIFAYLERIEHGQLPPELSGHSGVT
ELADGQATDSDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLLGQARLPAN
LQADAQALATTLVEALREKNSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGRGGEPL
IRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYARSQQDRTMSELLPRVRALALLARRY
DIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQGYQKRCPFVIDYLIDLARR
SRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQ
FATHNAYTLAAIYHLAGHNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVDEASKVVPLGAPHAKIPLPRH
LYGDERPNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALADAPARDVRNPADL
RDVVGTVSEATAEHVSAALAHAVAAAPIWQATPVDARADCLVRAADLLEAQMHTLMGLIV
REAGKSLPNAIAEIREAVDFLRYYAAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRLLREAGVPAGAVQLLPGTGETVGAALVADSRTR
AVMFTGSTEVARLINKTLSARLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSS
FDSAGQRCSALRVLCLQDDVADRTLTMLKGAMHELALGNPDRLSTDVGPVIDAEAKQTID
THVATMTDKGHTVTQLPAPEACAHGTFVPPTLIEIGSIDELKREVFGPVLHVVRYRRNQL
DKLLEQIRATGYGLTLGIHTRIDETIAHVISNAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPSGLPRSLAQMLIADGAVEGDSRGNPAAALTALRDWLIEQR
EPALAARCDGYLAQVPAGATAVLTGPTGERNTYTLGPRGTVLCVAATPSGARAQFAAVLA
TGNRALFAGAAGEALVAALPAALKAHAAVRKQPDAPFDAVLFEGDSDELQTLVKDVAQRP
GPIVSVQGVSAGAFENGDAEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences Q0BJK9
WP_011655625.1.34573 WP_011655625.1.59090 gi|115350159|ref|YP_771998.1| 339670.Bamb_0103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]