SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|115350212|ref|YP_772051.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115350212|ref|YP_772051.1|
Domain Number 1 Region: 1-274
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.4e-81
Family Phase 1 flagellin 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115350212|ref|YP_772051.1|
Sequence length 274
Comment flagellin [Burkholderia ambifaria AMMD]
Sequence
MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTAAINAL
TQGVSNANNGISMIQTAAGALQSTVDNLQRIRTLAVESGDGSLDSNARANLQAEVTTRLG
EIDRVATQTTFNGQTILSNAGNVTFQVGASANQTVAVNFGATVWTSTGAGLSLSGLTVSD
QTSAQSAITAIDTALKNVNTFQATLGAAQNTFQAAITTTQTQATNMSAARSQITDADFAT
ETANLSKAQVLQQAGISVLAQANSLPQQVLKLLQ
Download sequence
Identical sequences B1FCV8 Q0BJF6
WP_006751066.1.34573 WP_006751066.1.40091 WP_006751066.1.59090 gi|115350212|ref|YP_772051.1| 339670.Bamb_0156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]