SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115350244|ref|YP_772083.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115350244|ref|YP_772083.1|
Domain Number 1 Region: 5-274
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.18e-100
Family Methylenetetrahydrofolate reductase 0.000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|115350244|ref|YP_772083.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Burkholderia ambifaria AMMD]
Sequence
MKPIELSFEFFPPKTAEGVEKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLEAAPHLSCIGSSRADLRAILDQYRSHGIRHIVALRGDLPSGMGAVGELRYASELVSF
IRAEHGDWFHIEVAGYPEYHPQARSPKADLENFARKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFTQLMRFSEMCGAEVPRWVARRLESFGDDRDAIRAFGADV
VTSLCQRLVDAGVPGLHFYTLNTASATRTICERLAM
Download sequence
Identical sequences Q0BJC4
339670.Bamb_0188 gi|115350244|ref|YP_772083.1| WP_011655698.1.34573 WP_011655698.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]