SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115350360|ref|YP_772199.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115350360|ref|YP_772199.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.66e-33
Family Frataxin-like 0.0000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|115350360|ref|YP_772199.1|
Sequence length 108
Comment frataxin-like protein [Burkholderia ambifaria AMMD]
Sequence
MSDTEYLARAEAVLASVERTVDAANDGDHDIDLERNGSVLTLTFENGSKIIINLQPPMKE
LWIAAKAGGFHYRFVDGEWRDTRTGTEFFSALTDYATQQAGLPITFRA
Download sequence
Identical sequences B1T532 B1YRR7 Q0BJ08
WP_006758798.1.16599 WP_006758798.1.34573 WP_006758798.1.54386 WP_006758798.1.59090 gi|115350360|ref|YP_772199.1| 339670.Bamb_0305 398577.BamMC406_0314 gi|172059379|ref|YP_001807031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]