SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115351481|ref|YP_773320.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115351481|ref|YP_773320.1|
Domain Number 1 Region: 181-478,557-598
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.08e-90
Family Type II chitinase 0.00000000288
Further Details:      
 
Domain Number 2 Region: 45-165
Classification Level Classification E-value
Superfamily E set domains 4.62e-16
Family E-set domains of sugar-utilizing enzymes 0.0017
Further Details:      
 
Domain Number 3 Region: 478-556
Classification Level Classification E-value
Superfamily Chitinase insertion domain 5.04e-16
Family Chitinase insertion domain 0.0001
Further Details:      
 
Domain Number 4 Region: 608-701
Classification Level Classification E-value
Superfamily PKD domain 0.0000000271
Family PKD domain 0.01
Further Details:      
 
Domain Number 5 Region: 712-800
Classification Level Classification E-value
Superfamily PKD domain 0.0000235
Family PKD domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|115351481|ref|YP_773320.1|
Domain Number - Region: 818-853
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.00419
Family Carbohydrate binding domain 0.0056
Further Details:      
 
Domain Number - Region: 913-940
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.00693
Family Carbohydrate binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115351481|ref|YP_773320.1|
Sequence length 972
Comment chitinase [Burkholderia ambifaria AMMD]
Sequence
MAFKLKSHKRTPNIVIRRRSQRRAHVAYAALAAASALSFANAALAAPGKPSLKQYEITSQ
PHGFVEIDLQKAGVAPYKDLVKLNKKVDVPLPFDIWSNGTAVKAVAVVNGVVDPASEVKM
TPGGTQSGEVIANVKTPGVKKMQVRVIDANGASTDSAPLDVVVFDTISELADDLPNNASK
NHKPYANTSGSVVGTYFATWSIYDRKFNVDNVPVENLTHMLYGFVPICGGADVNASLAKD
LPGSFNTLQQSCKGLPDYSVAIHDTYGEMAKVLPGQTANSKLKGVLGQMMAAKKRNPNLK
ILPSIGGWTLSDPFFQMHDPAKRKVFVDSTEQLLRTWKFFDGVDIDWEFPGGKGVNPSLG
DPVKDGPLYVTLMKELRQMLDKLSQETGRKYELTSAIGAGKDKIDVVNYKEATKYMDYIF
DMTYDFYGAFSLTDLGHQTALYAPDWKPDTAYTTHNSIKALLAQGVDPKKLVVGAAAYAR
GWNGVHGYADGNPFTGTATGPHKGQWEPGILDYKKVKAEMIGPNNAGINGYEYHYDQTAE
APYVFNKSTGELLTFDDQRSVLAKGDYVRAHQLGGLFSWEIDADNGDILNAMHQGLGHGD
EGGGGAENHPPVANAGADMTVTGPQTVTLDASKSRDPDGDKLSFMWEQVGGDPLKLANAT
SAKASADVPSVKQDTKYTFRVTVTDPAGLKDTAQVVVTAQADATVEPPPAENRPPVAQLG
GPATAQAGQAVTLSAAKSTDPDGDKLSFKWSVPAGIDAKPTGATLSFTAPELAKDQSFTF
SVTVSDGKLSSTAKHTVLVKAKDAGGGEGGGEGGNGGGEYPAYKAGTQYNAGDIVSNLGK
LYQCKPFPNSGWCSGAPTAYEPGKGFAWSDAWTLYGDDEGGNGGNGGNGGGNGGGEGGNG
GGNGGGEGGNGGGDHPQYKEGTKYNAGDIVSNNGKLYRCKPFPYTNWCSMAAWAYEPGKG
TAWDQAWEAHNE
Download sequence
Identical sequences Q0BFT7
339670.Bamb_1428 WP_011656731.1.34573 WP_011656731.1.59090 gi|115351481|ref|YP_773320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]