SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115359626|ref|YP_776764.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115359626|ref|YP_776764.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily DOPA-like 1.83e-42
Family DOPA dioxygenase-like 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115359626|ref|YP_776764.1|
Sequence length 117
Comment aromatic ring-cleaving dioxygenase-like protein [Burkholderia ambifaria AMMD]
Sequence
MSDIDTTAIDSWHAHVYFDAASRDAAWAFRLVVEERFGAIIELGRFHERLVGPHPAWSYQ
IAFDAARFDTIVPWLVLNHGALDIFLHPNTNDELRDHRDSAVWIGKSHELNLGALGG
Download sequence
Identical sequences Q0B5Z3
gi|115359626|ref|YP_776764.1| 339670.Bamb_4881 WP_011659822.1.34573 WP_011659822.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]