SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115360161|ref|YP_777299.1| from Burkholderia ambifaria AMMD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115360161|ref|YP_777299.1|
Domain Number 1 Region: 445-581
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.77e-35
Family Flavohemoglobin, C-terminal domain 0.0007
Further Details:      
 
Domain Number 2 Region: 342-443
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.6e-26
Family Ferredoxin reductase FAD-binding domain-like 0.00059
Further Details:      
 
Domain Number 3 Region: 567-675
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.98e-19
Family 2Fe-2S ferredoxin-related 0.016
Further Details:      
 
Domain Number 4 Region: 178-298
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000154
Family PNP-oxidase like 0.016
Further Details:      
 
Weak hits

Sequence:  gi|115360161|ref|YP_777299.1|
Domain Number - Region: 47-145
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0118
Family PNP-oxidase like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115360161|ref|YP_777299.1|
Sequence length 684
Comment pyridoxamine 5'-phosphate oxidase-like FMN-binding protein [Burkholderia ambifaria AMMD]
Sequence
MTAPTAAVPGWELDVAPFHAGELAVQQRAGVTEAAGAAGRRGIRRFMPDQHRAFFAQLPF
FVLGGVDAHGQPWATLRVGMPGFVTAPDARTLHIGGDALPGDPLAGAWQPGAPLGGLGIE
FDTRRRNRVNGVVRAVDGGALTIAVEQSFGNCAKYIQGRKATFVAREGDASGTADVSDRL
SDADRALLAQADTFFVASANTSADAGAARGADVSHRGGMPGFVRVDDACTLTTPDFSGNR
FFNTLGNLQHDPRAGLLFIDFDSGDVLYVAARAEIVWDGPLVASFDGAQRVVRFHVREVR
RTRGVLPFRWSVPERAPQFAAIADGSANAGAQAASEPASASPSNWRPLRIAKIVDEARAI
RSFHFEPADGGALPAHEAGQHLTLRIALPDSDAPAIRSYTLSDAPGAPHYRITVKREGRV
SAWLHDHAHAGMTLDAQMPRGRFTFDVASPRPAVLVSAGIGITPMFAMLRRALADDTPSR
RVVFVHGSRDTADRPFAAELTRIADTDARVALHWFDSRPQRDGAARPGRIDVAQLKRILP
FDDYDFYLCGPSAFMRDLYDGLRALNVPDERIRFEAFGPSSVVRSAARATGVPSVASVPV
VFRRSARDAAWTPADGRLLEFAEGQGVAVPSECRSGSCGTCATRVLSGAVDYVQSHDAPV
EPGCALLCVAQPAEGATEPLVLDR
Download sequence
Identical sequences Q0B4F8
339670.Bamb_5418 gi|115360161|ref|YP_777299.1| WP_011660335.1.34573 WP_011660335.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]