SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148269484|ref|YP_001243944.1| from Thermotoga petrophila RKU-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148269484|ref|YP_001243944.1|
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.17e-59
Family PP-loop ATPase 0.0000199
Further Details:      
 
Domain Number 2 Region: 329-392
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.11e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148269484|ref|YP_001243944.1|
Sequence length 419
Comment tRNA(Ile)-lysidine synthetase [Thermotoga petrophila RKU-1]
Sequence
MKEEKLLEEGEHVLVAVSGGIDSMTLLYVLKKFSPLLKIKITAAHLDHRIRESSRRDREF
VERICRQWNVPVETSEVDVPSLWKDSGKTLEEIARELRYDFLRRTAKKVGATKIALAHHK
NDLLETVVHRLIRGTGPLGLACISPKREEFIRPFLVFKRSEIEEYAREKGVPYVVDETNY
DVKYTRNFIRHRIVPLMKELNPTVEDAVYRLVSVTLLLRNFVERTVQDFVERNVYFYKDY
AVFAEPEDPFFFLEVTRWVLKEMCGRVPEYEKLIGALKSKRVELWSGVFVERSFGYVAVG
KTVFREKYRVEVKGDMLEMEGFKIRVVNNRNDMKFWVRNRKEGDRIIVNGRERKLKDVFI
EKKVPTFYRDRVPLLVDEEDRVLWVPGIARSNFLPEDVVVELLEYPVGYVKGGTYFEQI
Download sequence
Identical sequences A0A101FBG6 A0A124FG45 A5IJJ5
gi|148269484|ref|YP_001243944.1| 390874.Tpet_0339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]