SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148269790|ref|YP_001244250.1| from Thermotoga petrophila RKU-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148269790|ref|YP_001244250.1|
Domain Number 1 Region: 9-279
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.61e-55
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148269790|ref|YP_001244250.1|
Sequence length 281
Comment methylenetetrahydrofolate reductase [Thermotoga petrophila RKU-1]
Sequence
MRKSLETGKCVVLEVLTPRGTNLDKFMEFTEEAWKTGIDAFTVTDMPMGRVRMAPWAASH
LLVESGKDVLMHFTRNTRNMIRIQSDLLGCHALGVKNLLLLSGDNPSHGDYPETTSVNDI
DILDLIRLTKLMNEGTDLAGNKIYGKTDFFVGGALNPFSDEDVERAKQKIEAGVDFLVTQ
PLFNSEVAKKIKEELNTKILASIVFFENAKQMSYFSNVPGIEIPDEIVNSAEKGDDYLKE
KSFESVLRFVEETKDVLDGFYIVAIVKDLEKIRKVVEIAKS
Download sequence
Identical sequences A5IKF1
WP_011943264.1.89131 390874.Tpet_0654 gi|148269790|ref|YP_001244250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]