SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148270824|ref|YP_001245284.1| from Thermotoga petrophila RKU-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148270824|ref|YP_001245284.1|
Domain Number 1 Region: 1-73,156-329
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.91e-64
Family Bacterial dinuclear zinc exopeptidases 0.00000000227
Further Details:      
 
Domain Number 2 Region: 75-150
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.00000000000000153
Family Aminopeptidase/glucanase lid domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148270824|ref|YP_001245284.1|
Sequence length 332
Comment peptidase M42 family protein [Thermotoga petrophila RKU-1]
Sequence
METRKLLMELSNLDGPSGYETNVVSYIKSIIEPFIDEARTTRHGSLIGYKKGKGIGKLAL
FAHVDEIGFVVSKVEGQFARLEPVGGVDPKVVYASKVRIYTKNGVERGVIGMLAPHLQDL
ESGKKVLMYDEIFVDLSLCERDVRVGDIAVIDQTAFEANGKVVGKALDNRASCGVLVKTL
EFLRKYDHLWDVYVVFSVQEETGCLGALTSAYEINPDVAIVMDVTFASEPPFSDHIELGK
GPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRSGTETDFVQLVRNGVRTSLISIP
LKYMHTPVEMVDPHDVEELARLLSLVAVELEV
Download sequence
Identical sequences A5IND5
WP_011944114.1.89131 gi|148270824|ref|YP_001245284.1| 390874.Tpet_1703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]