SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452122960|ref|YP_007473208.1| from Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452122960|ref|YP_007473208.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.46e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452122960|ref|YP_007473208.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRQARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A2I6NLS9
WP_000121524.1.100886 WP_000121524.1.101425 WP_000121524.1.10177 WP_000121524.1.101776 WP_000121524.1.16817 WP_000121524.1.18103 WP_000121524.1.1954 WP_000121524.1.19884 WP_000121524.1.19987 WP_000121524.1.2130 WP_000121524.1.21877 WP_000121524.1.22388 WP_000121524.1.23201 WP_000121524.1.26563 WP_000121524.1.26758 WP_000121524.1.27122 WP_000121524.1.30213 WP_000121524.1.30635 WP_000121524.1.3089 WP_000121524.1.31042 WP_000121524.1.3310 WP_000121524.1.34184 WP_000121524.1.35809 WP_000121524.1.36652 WP_000121524.1.42978 WP_000121524.1.43258 WP_000121524.1.49358 WP_000121524.1.50238 WP_000121524.1.52824 WP_000121524.1.53328 WP_000121524.1.5459 WP_000121524.1.55361 WP_000121524.1.56152 WP_000121524.1.61667 WP_000121524.1.62184 WP_000121524.1.63513 WP_000121524.1.63633 WP_000121524.1.64389 WP_000121524.1.6525 WP_000121524.1.65295 WP_000121524.1.65687 WP_000121524.1.66800 WP_000121524.1.67970 WP_000121524.1.68167 WP_000121524.1.68629 WP_000121524.1.69139 WP_000121524.1.7055 WP_000121524.1.71667 WP_000121524.1.73965 WP_000121524.1.76529 WP_000121524.1.7655 WP_000121524.1.78016 WP_000121524.1.80333 WP_000121524.1.80840 WP_000121524.1.81062 WP_000121524.1.8127 WP_000121524.1.84721 WP_000121524.1.88483 WP_000121524.1.88675 WP_000121524.1.92039 WP_000121524.1.95465 gi|452122960|ref|YP_007473208.1| ABEH02000003|CDS_406880-408898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]