SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452119981|ref|YP_007470229.1| from Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452119981|ref|YP_007470229.1|
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily CBS-domain pair 7.96e-23
Family CBS-domain pair 0.0062
Further Details:      
 
Domain Number 2 Region: 434-518
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.82e-17
Family CorC/HlyC domain-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|452119981|ref|YP_007470229.1|
Domain Number - Region: 7-227
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00366
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452119981|ref|YP_007470229.1|
Sequence length 519
Comment membrane protein TerC family/CBS/transporter associated domain protein [Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992]
Sequence
MELLMDPSIWVGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLIGLSLALIMRLA
LLSIISWLVTLTKPLFTVWDFTFSGRDLIMLLGGIFLLFKATTELHERLENREHDTGHGK
GYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSIVIEVFNQIARRNFIRHQS
TLPLRARTADAILRLMGGKRQTSTQHETDSPAAISVSEGAFAEEERYMINGVLTLASRSL
RGIMTPRGEISWVDANLSVAEIRQQLLSSPHSLFPVCRGELDEIIGIVRAKELLVALEEG
ADVAAIAASSPAIVVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAG
EFPDADETPEIVADAEGWIVKGGTDLHALQQALEVDHLVNEEGDIATVAGLVIAANGHIP
RVGDVIDVPPLRITIVEANDYRVDLVRIVKEQPAHDEEE
Download sequence
Identical sequences A0A0H3BXP1 A0A0R9MK41 A0A1X2RFL1 A0A232R1B5 A0A2I6MKM0 A0A2J5W5G2
gi|194446444|ref|YP_002041085.1| WP_000421820.1.100137 WP_000421820.1.100502 WP_000421820.1.100584 WP_000421820.1.100711 WP_000421820.1.100886 WP_000421820.1.101042 WP_000421820.1.101091 WP_000421820.1.101123 WP_000421820.1.101223 WP_000421820.1.101724 WP_000421820.1.101740 WP_000421820.1.101741 WP_000421820.1.101744 WP_000421820.1.101841 WP_000421820.1.10191 WP_000421820.1.10237 WP_000421820.1.10521 WP_000421820.1.10568 WP_000421820.1.10675 WP_000421820.1.11254 WP_000421820.1.11304 WP_000421820.1.11681 WP_000421820.1.11875 WP_000421820.1.11938 WP_000421820.1.12397 WP_000421820.1.12456 WP_000421820.1.1326 WP_000421820.1.14789 WP_000421820.1.15079 WP_000421820.1.15102 WP_000421820.1.15483 WP_000421820.1.15612 WP_000421820.1.15625 WP_000421820.1.15708 WP_000421820.1.158 WP_000421820.1.15909 WP_000421820.1.1601 WP_000421820.1.16125 WP_000421820.1.16172 WP_000421820.1.16331 WP_000421820.1.16817 WP_000421820.1.1689 WP_000421820.1.16941 WP_000421820.1.17098 WP_000421820.1.17285 WP_000421820.1.17447 WP_000421820.1.17693 WP_000421820.1.17755 WP_000421820.1.17991 WP_000421820.1.18103 WP_000421820.1.1897 WP_000421820.1.18972 WP_000421820.1.19240 WP_000421820.1.1990 WP_000421820.1.20349 WP_000421820.1.2036 WP_000421820.1.20391 WP_000421820.1.20425 WP_000421820.1.20503 WP_000421820.1.20695 WP_000421820.1.20789 WP_000421820.1.20894 WP_000421820.1.2091 WP_000421820.1.2130 WP_000421820.1.21728 WP_000421820.1.21792 WP_000421820.1.21825 WP_000421820.1.22388 WP_000421820.1.22514 WP_000421820.1.22845 WP_000421820.1.23309 WP_000421820.1.23513 WP_000421820.1.23670 WP_000421820.1.23736 WP_000421820.1.2376 WP_000421820.1.2415 WP_000421820.1.24163 WP_000421820.1.24392 WP_000421820.1.24433 WP_000421820.1.24444 WP_000421820.1.24567 WP_000421820.1.25072 WP_000421820.1.25498 WP_000421820.1.2554 WP_000421820.1.25722 WP_000421820.1.26269 WP_000421820.1.26363 WP_000421820.1.26426 WP_000421820.1.26563 WP_000421820.1.26576 WP_000421820.1.26980 WP_000421820.1.27122 WP_000421820.1.27255 WP_000421820.1.27342 WP_000421820.1.27419 WP_000421820.1.27513 WP_000421820.1.27522 WP_000421820.1.27523 WP_000421820.1.27616 WP_000421820.1.27755 WP_000421820.1.2825 WP_000421820.1.28301 WP_000421820.1.28612 WP_000421820.1.29593 WP_000421820.1.29775 WP_000421820.1.29923 WP_000421820.1.29924 WP_000421820.1.30238 WP_000421820.1.30356 WP_000421820.1.30437 WP_000421820.1.30619 WP_000421820.1.30635 WP_000421820.1.3080 WP_000421820.1.30909 WP_000421820.1.31156 WP_000421820.1.31210 WP_000421820.1.3127 WP_000421820.1.31476 WP_000421820.1.31720 WP_000421820.1.31725 WP_000421820.1.31845 WP_000421820.1.32277 WP_000421820.1.32902 WP_000421820.1.33010 WP_000421820.1.3310 WP_000421820.1.33160 WP_000421820.1.33499 WP_000421820.1.34184 WP_000421820.1.34259 WP_000421820.1.3445 WP_000421820.1.3476 WP_000421820.1.34817 WP_000421820.1.35648 WP_000421820.1.36157 WP_000421820.1.36751 WP_000421820.1.36978 WP_000421820.1.37013 WP_000421820.1.37028 WP_000421820.1.37190 WP_000421820.1.37558 WP_000421820.1.3756 WP_000421820.1.38199 WP_000421820.1.38881 WP_000421820.1.38895 WP_000421820.1.39113 WP_000421820.1.39471 WP_000421820.1.39576 WP_000421820.1.40648 WP_000421820.1.40979 WP_000421820.1.41345 WP_000421820.1.42248 WP_000421820.1.42262 WP_000421820.1.4239 WP_000421820.1.42605 WP_000421820.1.42707 WP_000421820.1.42797 WP_000421820.1.42829 WP_000421820.1.42887 WP_000421820.1.4289 WP_000421820.1.42978 WP_000421820.1.43070 WP_000421820.1.43258 WP_000421820.1.43438 WP_000421820.1.43508 WP_000421820.1.43528 WP_000421820.1.43535 WP_000421820.1.43710 WP_000421820.1.43782 WP_000421820.1.43875 WP_000421820.1.43954 WP_000421820.1.4405 WP_000421820.1.44132 WP_000421820.1.44438 WP_000421820.1.44440 WP_000421820.1.44443 WP_000421820.1.44633 WP_000421820.1.44678 WP_000421820.1.44833 WP_000421820.1.44950 WP_000421820.1.45522 WP_000421820.1.45535 WP_000421820.1.45984 WP_000421820.1.46124 WP_000421820.1.46203 WP_000421820.1.46406 WP_000421820.1.46444 WP_000421820.1.46693 WP_000421820.1.4671 WP_000421820.1.46730 WP_000421820.1.46732 WP_000421820.1.46961 WP_000421820.1.47714 WP_000421820.1.4775 WP_000421820.1.47817 WP_000421820.1.47849 WP_000421820.1.47928 WP_000421820.1.48262 WP_000421820.1.49102 WP_000421820.1.49175 WP_000421820.1.49226 WP_000421820.1.49233 WP_000421820.1.49358 WP_000421820.1.49827 WP_000421820.1.50003 WP_000421820.1.50238 WP_000421820.1.50285 WP_000421820.1.50565 WP_000421820.1.5058 WP_000421820.1.50893 WP_000421820.1.51139 WP_000421820.1.51162 WP_000421820.1.51285 WP_000421820.1.51308 WP_000421820.1.51394 WP_000421820.1.51514 WP_000421820.1.51611 WP_000421820.1.51613 WP_000421820.1.52047 WP_000421820.1.52156 WP_000421820.1.52161 WP_000421820.1.52528 WP_000421820.1.52748 WP_000421820.1.53016 WP_000421820.1.5316 WP_000421820.1.53206 WP_000421820.1.53534 WP_000421820.1.53694 WP_000421820.1.54061 WP_000421820.1.54082 WP_000421820.1.54333 WP_000421820.1.54694 WP_000421820.1.5517 WP_000421820.1.55223 WP_000421820.1.55361 WP_000421820.1.55477 WP_000421820.1.55496 WP_000421820.1.55545 WP_000421820.1.55706 WP_000421820.1.55718 WP_000421820.1.56152 WP_000421820.1.56247 WP_000421820.1.56368 WP_000421820.1.56393 WP_000421820.1.56651 WP_000421820.1.56905 WP_000421820.1.57125 WP_000421820.1.57149 WP_000421820.1.57357 WP_000421820.1.57399 WP_000421820.1.57641 WP_000421820.1.58157 WP_000421820.1.58249 WP_000421820.1.58301 WP_000421820.1.58698 WP_000421820.1.58932 WP_000421820.1.59097 WP_000421820.1.59136 WP_000421820.1.59294 WP_000421820.1.59512 WP_000421820.1.59648 WP_000421820.1.59928 WP_000421820.1.5993 WP_000421820.1.60004 WP_000421820.1.60052 WP_000421820.1.60370 WP_000421820.1.60608 WP_000421820.1.60746 WP_000421820.1.60838 WP_000421820.1.60855 WP_000421820.1.6108 WP_000421820.1.61233 WP_000421820.1.61497 WP_000421820.1.61509 WP_000421820.1.61662 WP_000421820.1.6190 WP_000421820.1.62076 WP_000421820.1.6210 WP_000421820.1.62222 WP_000421820.1.62404 WP_000421820.1.62486 WP_000421820.1.63043 WP_000421820.1.63150 WP_000421820.1.63234 WP_000421820.1.63243 WP_000421820.1.63781 WP_000421820.1.63824 WP_000421820.1.63831 WP_000421820.1.63992 WP_000421820.1.64208 WP_000421820.1.64242 WP_000421820.1.64266 WP_000421820.1.6437 WP_000421820.1.64412 WP_000421820.1.65168 WP_000421820.1.65238 WP_000421820.1.6572 WP_000421820.1.65790 WP_000421820.1.65795 WP_000421820.1.65838 WP_000421820.1.6594 WP_000421820.1.66082 WP_000421820.1.66129 WP_000421820.1.66167 WP_000421820.1.66235 WP_000421820.1.66365 WP_000421820.1.6647 WP_000421820.1.66534 WP_000421820.1.66800 WP_000421820.1.66824 WP_000421820.1.6692 WP_000421820.1.67184 WP_000421820.1.67374 WP_000421820.1.67905 WP_000421820.1.67924 WP_000421820.1.68167 WP_000421820.1.68629 WP_000421820.1.68690 WP_000421820.1.68818 WP_000421820.1.6882 WP_000421820.1.68958 WP_000421820.1.68999 WP_000421820.1.6907 WP_000421820.1.69288 WP_000421820.1.69320 WP_000421820.1.69346 WP_000421820.1.69754 WP_000421820.1.69807 WP_000421820.1.69890 WP_000421820.1.7010 WP_000421820.1.7014 WP_000421820.1.7016 WP_000421820.1.70290 WP_000421820.1.70326 WP_000421820.1.70523 WP_000421820.1.70547 WP_000421820.1.70644 WP_000421820.1.70914 WP_000421820.1.71248 WP_000421820.1.71500 WP_000421820.1.71929 WP_000421820.1.72220 WP_000421820.1.72277 WP_000421820.1.72351 WP_000421820.1.72382 WP_000421820.1.72894 WP_000421820.1.72968 WP_000421820.1.73144 WP_000421820.1.73164 WP_000421820.1.73270 WP_000421820.1.73596 WP_000421820.1.73901 WP_000421820.1.7394 WP_000421820.1.74117 WP_000421820.1.74402 WP_000421820.1.74422 WP_000421820.1.74500 WP_000421820.1.74632 WP_000421820.1.74639 WP_000421820.1.74992 WP_000421820.1.74996 WP_000421820.1.75180 WP_000421820.1.75793 WP_000421820.1.75957 WP_000421820.1.76208 WP_000421820.1.76301 WP_000421820.1.7655 WP_000421820.1.76724 WP_000421820.1.76738 WP_000421820.1.77033 WP_000421820.1.77184 WP_000421820.1.77271 WP_000421820.1.77436 WP_000421820.1.77543 WP_000421820.1.77565 WP_000421820.1.77754 WP_000421820.1.77987 WP_000421820.1.78245 WP_000421820.1.78602 WP_000421820.1.78862 WP_000421820.1.7891 WP_000421820.1.78951 WP_000421820.1.79032 WP_000421820.1.79302 WP_000421820.1.79370 WP_000421820.1.79832 WP_000421820.1.79914 WP_000421820.1.79966 WP_000421820.1.80333 WP_000421820.1.80443 WP_000421820.1.80479 WP_000421820.1.80480 WP_000421820.1.80542 WP_000421820.1.80667 WP_000421820.1.80674 WP_000421820.1.80750 WP_000421820.1.80913 WP_000421820.1.80959 WP_000421820.1.81062 WP_000421820.1.81107 WP_000421820.1.81321 WP_000421820.1.81667 WP_000421820.1.81795 WP_000421820.1.82099 WP_000421820.1.82395 WP_000421820.1.82584 WP_000421820.1.82763 WP_000421820.1.82895 WP_000421820.1.83061 WP_000421820.1.83119 WP_000421820.1.8322 WP_000421820.1.83407 WP_000421820.1.83516 WP_000421820.1.83759 WP_000421820.1.83897 WP_000421820.1.83960 WP_000421820.1.84001 WP_000421820.1.84077 WP_000421820.1.84100 WP_000421820.1.84683 WP_000421820.1.85120 WP_000421820.1.85126 WP_000421820.1.8552 WP_000421820.1.85742 WP_000421820.1.86285 WP_000421820.1.86316 WP_000421820.1.86335 WP_000421820.1.86389 WP_000421820.1.86601 WP_000421820.1.86807 WP_000421820.1.86860 WP_000421820.1.86982 WP_000421820.1.87051 WP_000421820.1.87219 WP_000421820.1.87346 WP_000421820.1.87370 WP_000421820.1.87618 WP_000421820.1.87813 WP_000421820.1.88136 WP_000421820.1.88165 WP_000421820.1.88483 WP_000421820.1.88698 WP_000421820.1.88762 WP_000421820.1.88967 WP_000421820.1.89452 WP_000421820.1.89632 WP_000421820.1.89940 WP_000421820.1.89965 WP_000421820.1.90440 WP_000421820.1.90625 WP_000421820.1.9064 WP_000421820.1.90701 WP_000421820.1.90866 WP_000421820.1.90878 WP_000421820.1.90984 WP_000421820.1.91453 WP_000421820.1.91579 WP_000421820.1.92047 WP_000421820.1.92439 WP_000421820.1.92529 WP_000421820.1.92895 WP_000421820.1.93061 WP_000421820.1.93213 WP_000421820.1.93596 WP_000421820.1.93691 WP_000421820.1.93741 WP_000421820.1.93761 WP_000421820.1.94039 WP_000421820.1.94352 WP_000421820.1.94798 WP_000421820.1.94817 WP_000421820.1.94982 WP_000421820.1.94987 WP_000421820.1.9516 WP_000421820.1.95249 WP_000421820.1.95289 WP_000421820.1.95298 WP_000421820.1.95579 WP_000421820.1.95744 WP_000421820.1.96141 WP_000421820.1.96203 WP_000421820.1.96721 WP_000421820.1.96798 WP_000421820.1.97109 WP_000421820.1.97185 WP_000421820.1.97260 WP_000421820.1.97369 WP_000421820.1.97480 WP_000421820.1.97800 WP_000421820.1.97907 WP_000421820.1.9805 WP_000421820.1.98402 WP_000421820.1.98513 WP_000421820.1.98551 WP_000421820.1.98634 WP_000421820.1.98763 WP_000421820.1.98947 WP_000421820.1.99725 WP_000421820.1.99824 gi|452119981|ref|YP_007470229.1| gi|161613662|ref|YP_001587627.1| 272994.SPAB_01386 423368.SNSL254_A1968 ABEW01000001|CDS_165766-167325 ABFG01000001|CDS_404648-406207 CP000886|CDS_1191619-1193178 CP001113|CDS_1926429-1924870 gi|549479581|ref|YP_008613612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]