SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452121861|ref|YP_007472109.1| from Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452121861|ref|YP_007472109.1|
Domain Number 1 Region: 344-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.23e-24
Family CorC/HlyC domain-like 0.0000439
Further Details:      
 
Domain Number 2 Region: 200-335
Classification Level Classification E-value
Superfamily CBS-domain pair 6.96e-22
Family CBS-domain pair 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452121861|ref|YP_007472109.1|
Sequence length 447
Comment transporter [Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992]
Sequence
MLNSIFIIFCLIAVSAFFSISEISLAASRKIKLKLLADEGSINAQRVLKMQENPGMFFTV
VQIGLNAVAILGGIVGDAAFSPAFSALFSHYMSPELSEQLSFILSFSLVTGLFILFADLT
PKRIGMIAPEAVALRIINPMRFCLFVFRPLVWLFNGMANNIFRLFKIPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRESIIWFDLHEDEQSLKKKVAE
HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSMALNGGVQIRNTLIVPDTLTLSEALE
SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLVDGGTP
IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFSGYKFEVVDIDNYRIDQL
LVTRLDNKSNVPAPKLPDAQGKEDSAA
Download sequence
Identical sequences A0A0N1QWY4 A0A124CYW0 A0A1C2ZW68 A0A1S0ZD81 A0A1U7FJG5 A0A1X2RR03 A0A221YTI1 A0A271CJE3 A0A271D1G4 A0A2D1XWR4 A0A2I6MDA0 A0A2I6MQU4 A0A2I6N4K3 A0A2I6NI23 A0A2I6NW42 G4C9W9 G5MDF3 G5NLR0 G5QC16 G5QTC7 G5R9B4
WP_000934970.1.100137 WP_000934970.1.100642 WP_000934970.1.10065 WP_000934970.1.100714 WP_000934970.1.10074 WP_000934970.1.100814 WP_000934970.1.100886 WP_000934970.1.100944 WP_000934970.1.101147 WP_000934970.1.101199 WP_000934970.1.101425 WP_000934970.1.101519 WP_000934970.1.101609 WP_000934970.1.10164 WP_000934970.1.101666 WP_000934970.1.10177 WP_000934970.1.101776 WP_000934970.1.101839 WP_000934970.1.101868 WP_000934970.1.101949 WP_000934970.1.10276 WP_000934970.1.10293 WP_000934970.1.10465 WP_000934970.1.106 WP_000934970.1.11041 WP_000934970.1.113 WP_000934970.1.1135 WP_000934970.1.11444 WP_000934970.1.11479 WP_000934970.1.11511 WP_000934970.1.11603 WP_000934970.1.11681 WP_000934970.1.12144 WP_000934970.1.12159 WP_000934970.1.12282 WP_000934970.1.1246 WP_000934970.1.12472 WP_000934970.1.1250 WP_000934970.1.12864 WP_000934970.1.1299 WP_000934970.1.13429 WP_000934970.1.13528 WP_000934970.1.13543 WP_000934970.1.13691 WP_000934970.1.13750 WP_000934970.1.13764 WP_000934970.1.13799 WP_000934970.1.13827 WP_000934970.1.13848 WP_000934970.1.13857 WP_000934970.1.14011 WP_000934970.1.14296 WP_000934970.1.14369 WP_000934970.1.14495 WP_000934970.1.14884 WP_000934970.1.14917 WP_000934970.1.14927 WP_000934970.1.14964 WP_000934970.1.15054 WP_000934970.1.15059 WP_000934970.1.15616 WP_000934970.1.15795 WP_000934970.1.16000 WP_000934970.1.1611 WP_000934970.1.16201 WP_000934970.1.16273 WP_000934970.1.16508 WP_000934970.1.16804 WP_000934970.1.16817 WP_000934970.1.16846 WP_000934970.1.16910 WP_000934970.1.16942 WP_000934970.1.16998 WP_000934970.1.17270 WP_000934970.1.17439 WP_000934970.1.1749 WP_000934970.1.17560 WP_000934970.1.17901 WP_000934970.1.18103 WP_000934970.1.18177 WP_000934970.1.18277 WP_000934970.1.18365 WP_000934970.1.18426 WP_000934970.1.18489 WP_000934970.1.18895 WP_000934970.1.19038 WP_000934970.1.19064 WP_000934970.1.19174 WP_000934970.1.19291 WP_000934970.1.19340 WP_000934970.1.1939 WP_000934970.1.19405 WP_000934970.1.1954 WP_000934970.1.19683 WP_000934970.1.19723 WP_000934970.1.19863 WP_000934970.1.19884 WP_000934970.1.19970 WP_000934970.1.19987 WP_000934970.1.20091 WP_000934970.1.20218 WP_000934970.1.2026 WP_000934970.1.20349 WP_000934970.1.20364 WP_000934970.1.20631 WP_000934970.1.20760 WP_000934970.1.20787 WP_000934970.1.20810 WP_000934970.1.20839 WP_000934970.1.21181 WP_000934970.1.21286 WP_000934970.1.2130 WP_000934970.1.21309 WP_000934970.1.21326 WP_000934970.1.21362 WP_000934970.1.21399 WP_000934970.1.21423 WP_000934970.1.21443 WP_000934970.1.21473 WP_000934970.1.21728 WP_000934970.1.21730 WP_000934970.1.21877 WP_000934970.1.21886 WP_000934970.1.21910 WP_000934970.1.21940 WP_000934970.1.22069 WP_000934970.1.22169 WP_000934970.1.22205 WP_000934970.1.22323 WP_000934970.1.22388 WP_000934970.1.22565 WP_000934970.1.2283 WP_000934970.1.22855 WP_000934970.1.22966 WP_000934970.1.23053 WP_000934970.1.23175 WP_000934970.1.23201 WP_000934970.1.23246 WP_000934970.1.23274 WP_000934970.1.23279 WP_000934970.1.23311 WP_000934970.1.23343 WP_000934970.1.23409 WP_000934970.1.2342 WP_000934970.1.23444 WP_000934970.1.235 WP_000934970.1.23500 WP_000934970.1.23639 WP_000934970.1.237 WP_000934970.1.23720 WP_000934970.1.2380 WP_000934970.1.24303 WP_000934970.1.24412 WP_000934970.1.24419 WP_000934970.1.24450 WP_000934970.1.24521 WP_000934970.1.24567 WP_000934970.1.2467 WP_000934970.1.24686 WP_000934970.1.24689 WP_000934970.1.24727 WP_000934970.1.24839 WP_000934970.1.25064 WP_000934970.1.25130 WP_000934970.1.25217 WP_000934970.1.25229 WP_000934970.1.25297 WP_000934970.1.25397 WP_000934970.1.25596 WP_000934970.1.2581 WP_000934970.1.25825 WP_000934970.1.26034 WP_000934970.1.26075 WP_000934970.1.26213 WP_000934970.1.26563 WP_000934970.1.2667 WP_000934970.1.26758 WP_000934970.1.26787 WP_000934970.1.26833 WP_000934970.1.26892 WP_000934970.1.26924 WP_000934970.1.27051 WP_000934970.1.27055 WP_000934970.1.27122 WP_000934970.1.27169 WP_000934970.1.27452 WP_000934970.1.27535 WP_000934970.1.27655 WP_000934970.1.27679 WP_000934970.1.27798 WP_000934970.1.27969 WP_000934970.1.2806 WP_000934970.1.28073 WP_000934970.1.28116 WP_000934970.1.28174 WP_000934970.1.28267 WP_000934970.1.28673 WP_000934970.1.28830 WP_000934970.1.28963 WP_000934970.1.29530 WP_000934970.1.29593 WP_000934970.1.29682 WP_000934970.1.29768 WP_000934970.1.30018 WP_000934970.1.30170 WP_000934970.1.30213 WP_000934970.1.30225 WP_000934970.1.30386 WP_000934970.1.30389 WP_000934970.1.30425 WP_000934970.1.3066 WP_000934970.1.3076 WP_000934970.1.30803 WP_000934970.1.30819 WP_000934970.1.30823 WP_000934970.1.3089 WP_000934970.1.30934 WP_000934970.1.3095 WP_000934970.1.31001 WP_000934970.1.31011 WP_000934970.1.31042 WP_000934970.1.31198 WP_000934970.1.31262 WP_000934970.1.3170 WP_000934970.1.3185 WP_000934970.1.32006 WP_000934970.1.32038 WP_000934970.1.32054 WP_000934970.1.32056 WP_000934970.1.32170 WP_000934970.1.32204 WP_000934970.1.32275 WP_000934970.1.32368 WP_000934970.1.32459 WP_000934970.1.32545 WP_000934970.1.32624 WP_000934970.1.32930 WP_000934970.1.3304 WP_000934970.1.3310 WP_000934970.1.33114 WP_000934970.1.33144 WP_000934970.1.33486 WP_000934970.1.33659 WP_000934970.1.33693 WP_000934970.1.34022 WP_000934970.1.34081 WP_000934970.1.34179 WP_000934970.1.34184 WP_000934970.1.34304 WP_000934970.1.34647 WP_000934970.1.34703 WP_000934970.1.34704 WP_000934970.1.34707 WP_000934970.1.34745 WP_000934970.1.34801 WP_000934970.1.35035 WP_000934970.1.35075 WP_000934970.1.35125 WP_000934970.1.35294 WP_000934970.1.3556 WP_000934970.1.35809 WP_000934970.1.35993 WP_000934970.1.3610 WP_000934970.1.36172 WP_000934970.1.36236 WP_000934970.1.36286 WP_000934970.1.36425 WP_000934970.1.36564 WP_000934970.1.36592 WP_000934970.1.36652 WP_000934970.1.36765 WP_000934970.1.36792 WP_000934970.1.36839 WP_000934970.1.3688 WP_000934970.1.37028 WP_000934970.1.37100 WP_000934970.1.37267 WP_000934970.1.37363 WP_000934970.1.3751 WP_000934970.1.37610 WP_000934970.1.37719 WP_000934970.1.37808 WP_000934970.1.38322 WP_000934970.1.38349 WP_000934970.1.38512 WP_000934970.1.38622 WP_000934970.1.38797 WP_000934970.1.38830 WP_000934970.1.38857 WP_000934970.1.38898 WP_000934970.1.38942 WP_000934970.1.39075 WP_000934970.1.39128 WP_000934970.1.39140 WP_000934970.1.39146 WP_000934970.1.39183 WP_000934970.1.39275 WP_000934970.1.39311 WP_000934970.1.39808 WP_000934970.1.40008 WP_000934970.1.40025 WP_000934970.1.40205 WP_000934970.1.40254 WP_000934970.1.40374 WP_000934970.1.40492 WP_000934970.1.40583 WP_000934970.1.40605 WP_000934970.1.40693 WP_000934970.1.40722 WP_000934970.1.4088 WP_000934970.1.41299 WP_000934970.1.41468 WP_000934970.1.41862 WP_000934970.1.41897 WP_000934970.1.41904 WP_000934970.1.41931 WP_000934970.1.41994 WP_000934970.1.42109 WP_000934970.1.42244 WP_000934970.1.42356 WP_000934970.1.42404 WP_000934970.1.42433 WP_000934970.1.42655 WP_000934970.1.42794 WP_000934970.1.42978 WP_000934970.1.42981 WP_000934970.1.43089 WP_000934970.1.43149 WP_000934970.1.43258 WP_000934970.1.4332 WP_000934970.1.43520 WP_000934970.1.43654 WP_000934970.1.43839 WP_000934970.1.43954 WP_000934970.1.44063 WP_000934970.1.44191 WP_000934970.1.4422 WP_000934970.1.4423 WP_000934970.1.44339 WP_000934970.1.44380 WP_000934970.1.44549 WP_000934970.1.44795 WP_000934970.1.44985 WP_000934970.1.44996 WP_000934970.1.44998 WP_000934970.1.45154 WP_000934970.1.45229 WP_000934970.1.45251 WP_000934970.1.45268 WP_000934970.1.45322 WP_000934970.1.45566 WP_000934970.1.45984 WP_000934970.1.46345 WP_000934970.1.46689 WP_000934970.1.46803 WP_000934970.1.46804 WP_000934970.1.47005 WP_000934970.1.47014 WP_000934970.1.47058 WP_000934970.1.47442 WP_000934970.1.47492 WP_000934970.1.47587 WP_000934970.1.48124 WP_000934970.1.48132 WP_000934970.1.48218 WP_000934970.1.48247 WP_000934970.1.48262 WP_000934970.1.48651 WP_000934970.1.48774 WP_000934970.1.48908 WP_000934970.1.48918 WP_000934970.1.48931 WP_000934970.1.49005 WP_000934970.1.49090 WP_000934970.1.49162 WP_000934970.1.49262 WP_000934970.1.49358 WP_000934970.1.49375 WP_000934970.1.49443 WP_000934970.1.49550 WP_000934970.1.49574 WP_000934970.1.49590 WP_000934970.1.49602 WP_000934970.1.49647 WP_000934970.1.49650 WP_000934970.1.49778 WP_000934970.1.49780 WP_000934970.1.50 WP_000934970.1.50238 WP_000934970.1.50349 WP_000934970.1.50386 WP_000934970.1.50478 WP_000934970.1.50480 WP_000934970.1.50517 WP_000934970.1.50769 WP_000934970.1.50811 WP_000934970.1.50893 WP_000934970.1.50918 WP_000934970.1.50954 WP_000934970.1.51025 WP_000934970.1.51178 WP_000934970.1.51338 WP_000934970.1.51419 WP_000934970.1.51914 WP_000934970.1.52356 WP_000934970.1.52456 WP_000934970.1.52527 WP_000934970.1.52608 WP_000934970.1.52675 WP_000934970.1.5273 WP_000934970.1.52824 WP_000934970.1.52858 WP_000934970.1.5301 WP_000934970.1.53100 WP_000934970.1.53158 WP_000934970.1.53179 WP_000934970.1.53203 WP_000934970.1.53274 WP_000934970.1.53328 WP_000934970.1.54159 WP_000934970.1.54500 WP_000934970.1.5459 WP_000934970.1.54822 WP_000934970.1.54984 WP_000934970.1.5525 WP_000934970.1.55361 WP_000934970.1.55461 WP_000934970.1.55672 WP_000934970.1.55680 WP_000934970.1.56130 WP_000934970.1.56152 WP_000934970.1.56222 WP_000934970.1.56354 WP_000934970.1.56413 WP_000934970.1.56420 WP_000934970.1.56642 WP_000934970.1.57233 WP_000934970.1.57494 WP_000934970.1.57495 WP_000934970.1.57510 WP_000934970.1.57709 WP_000934970.1.57710 WP_000934970.1.57778 WP_000934970.1.57781 WP_000934970.1.5781 WP_000934970.1.57857 WP_000934970.1.58153 WP_000934970.1.58251 WP_000934970.1.58357 WP_000934970.1.5846 WP_000934970.1.58633 WP_000934970.1.58729 WP_000934970.1.59012 WP_000934970.1.59148 WP_000934970.1.59236 WP_000934970.1.59295 WP_000934970.1.59412 WP_000934970.1.59439 WP_000934970.1.59486 WP_000934970.1.59562 WP_000934970.1.59587 WP_000934970.1.59604 WP_000934970.1.59709 WP_000934970.1.59755 WP_000934970.1.60231 WP_000934970.1.60469 WP_000934970.1.6052 WP_000934970.1.60851 WP_000934970.1.60857 WP_000934970.1.6086 WP_000934970.1.6090 WP_000934970.1.60926 WP_000934970.1.60976 WP_000934970.1.60988 WP_000934970.1.61114 WP_000934970.1.61200 WP_000934970.1.61434 WP_000934970.1.61582 WP_000934970.1.61667 WP_000934970.1.61743 WP_000934970.1.6190 WP_000934970.1.61968 WP_000934970.1.62108 WP_000934970.1.62120 WP_000934970.1.62122 WP_000934970.1.62142 WP_000934970.1.62184 WP_000934970.1.62310 WP_000934970.1.62361 WP_000934970.1.62488 WP_000934970.1.62522 WP_000934970.1.62828 WP_000934970.1.62976 WP_000934970.1.63455 WP_000934970.1.63499 WP_000934970.1.63513 WP_000934970.1.6357 WP_000934970.1.63633 WP_000934970.1.63782 WP_000934970.1.64294 WP_000934970.1.64389 WP_000934970.1.64771 WP_000934970.1.64944 WP_000934970.1.64972 WP_000934970.1.65022 WP_000934970.1.6525 WP_000934970.1.65295 WP_000934970.1.65348 WP_000934970.1.65363 WP_000934970.1.65437 WP_000934970.1.6550 WP_000934970.1.65538 WP_000934970.1.65558 WP_000934970.1.6560 WP_000934970.1.65687 WP_000934970.1.65968 WP_000934970.1.66082 WP_000934970.1.66085 WP_000934970.1.66250 WP_000934970.1.66368 WP_000934970.1.66462 WP_000934970.1.66702 WP_000934970.1.66779 WP_000934970.1.66800 WP_000934970.1.66825 WP_000934970.1.67175 WP_000934970.1.67405 WP_000934970.1.67424 WP_000934970.1.67603 WP_000934970.1.67617 WP_000934970.1.67633 WP_000934970.1.67637 WP_000934970.1.67776 WP_000934970.1.67970 WP_000934970.1.67988 WP_000934970.1.68075 WP_000934970.1.68115 WP_000934970.1.68167 WP_000934970.1.6858 WP_000934970.1.6879 WP_000934970.1.68816 WP_000934970.1.6883 WP_000934970.1.69011 WP_000934970.1.6905 WP_000934970.1.69058 WP_000934970.1.69139 WP_000934970.1.69385 WP_000934970.1.69592 WP_000934970.1.69597 WP_000934970.1.69710 WP_000934970.1.69760 WP_000934970.1.69817 WP_000934970.1.69982 WP_000934970.1.70047 WP_000934970.1.70087 WP_000934970.1.70183 WP_000934970.1.70281 WP_000934970.1.70290 WP_000934970.1.70355 WP_000934970.1.7044 WP_000934970.1.70491 WP_000934970.1.7055 WP_000934970.1.70685 WP_000934970.1.70712 WP_000934970.1.70792 WP_000934970.1.7093 WP_000934970.1.70986 WP_000934970.1.71150 WP_000934970.1.71450 WP_000934970.1.71452 WP_000934970.1.71583 WP_000934970.1.71667 WP_000934970.1.71923 WP_000934970.1.72277 WP_000934970.1.72283 WP_000934970.1.72412 WP_000934970.1.7243 WP_000934970.1.72671 WP_000934970.1.72843 WP_000934970.1.72894 WP_000934970.1.72944 WP_000934970.1.7316 WP_000934970.1.73328 WP_000934970.1.73362 WP_000934970.1.73379 WP_000934970.1.7341 WP_000934970.1.73512 WP_000934970.1.7374 WP_000934970.1.73965 WP_000934970.1.74028 WP_000934970.1.74228 WP_000934970.1.74428 WP_000934970.1.74469 WP_000934970.1.74570 WP_000934970.1.7458 WP_000934970.1.74632 WP_000934970.1.74807 WP_000934970.1.74876 WP_000934970.1.74946 WP_000934970.1.75114 WP_000934970.1.75134 WP_000934970.1.75168 WP_000934970.1.7531 WP_000934970.1.75664 WP_000934970.1.76 WP_000934970.1.76164 WP_000934970.1.76186 WP_000934970.1.76197 WP_000934970.1.7629 WP_000934970.1.7633 WP_000934970.1.76346 WP_000934970.1.76529 WP_000934970.1.7655 WP_000934970.1.7657 WP_000934970.1.76611 WP_000934970.1.7672 WP_000934970.1.77033 WP_000934970.1.77431 WP_000934970.1.77440 WP_000934970.1.77575 WP_000934970.1.77629 WP_000934970.1.77761 WP_000934970.1.78016 WP_000934970.1.78026 WP_000934970.1.78168 WP_000934970.1.78180 WP_000934970.1.78259 WP_000934970.1.78339 WP_000934970.1.78366 WP_000934970.1.78502 WP_000934970.1.78789 WP_000934970.1.78913 WP_000934970.1.7893 WP_000934970.1.78951 WP_000934970.1.79081 WP_000934970.1.79189 WP_000934970.1.7956 WP_000934970.1.79635 WP_000934970.1.79778 WP_000934970.1.79892 WP_000934970.1.79942 WP_000934970.1.79945 WP_000934970.1.80149 WP_000934970.1.80229 WP_000934970.1.8024 WP_000934970.1.80333 WP_000934970.1.80496 WP_000934970.1.80638 WP_000934970.1.80707 WP_000934970.1.80723 WP_000934970.1.80819 WP_000934970.1.80840 WP_000934970.1.80927 WP_000934970.1.81062 WP_000934970.1.81067 WP_000934970.1.81107 WP_000934970.1.81118 WP_000934970.1.81231 WP_000934970.1.8127 WP_000934970.1.81409 WP_000934970.1.81548 WP_000934970.1.8168 WP_000934970.1.81746 WP_000934970.1.81965 WP_000934970.1.82141 WP_000934970.1.82144 WP_000934970.1.82258 WP_000934970.1.82347 WP_000934970.1.82352 WP_000934970.1.8236 WP_000934970.1.82369 WP_000934970.1.82530 WP_000934970.1.82636 WP_000934970.1.82637 WP_000934970.1.82843 WP_000934970.1.82899 WP_000934970.1.83221 WP_000934970.1.83247 WP_000934970.1.83252 WP_000934970.1.83301 WP_000934970.1.83360 WP_000934970.1.83388 WP_000934970.1.83572 WP_000934970.1.84106 WP_000934970.1.84115 WP_000934970.1.84198 WP_000934970.1.84205 WP_000934970.1.84229 WP_000934970.1.84403 WP_000934970.1.84551 WP_000934970.1.84721 WP_000934970.1.850 WP_000934970.1.85014 WP_000934970.1.85031 WP_000934970.1.85094 WP_000934970.1.85147 WP_000934970.1.85192 WP_000934970.1.85433 WP_000934970.1.85654 WP_000934970.1.85784 WP_000934970.1.85797 WP_000934970.1.85854 WP_000934970.1.8591 WP_000934970.1.86017 WP_000934970.1.86092 WP_000934970.1.86120 WP_000934970.1.86126 WP_000934970.1.86206 WP_000934970.1.86259 WP_000934970.1.86442 WP_000934970.1.86634 WP_000934970.1.86658 WP_000934970.1.86676 WP_000934970.1.86699 WP_000934970.1.86744 WP_000934970.1.86902 WP_000934970.1.86921 WP_000934970.1.87584 WP_000934970.1.8767 WP_000934970.1.87813 WP_000934970.1.87933 WP_000934970.1.8800 WP_000934970.1.88136 WP_000934970.1.88165 WP_000934970.1.88483 WP_000934970.1.88597 WP_000934970.1.88620 WP_000934970.1.88675 WP_000934970.1.88776 WP_000934970.1.88942 WP_000934970.1.89174 WP_000934970.1.89311 WP_000934970.1.89462 WP_000934970.1.89580 WP_000934970.1.89647 WP_000934970.1.89746 WP_000934970.1.89777 WP_000934970.1.89914 WP_000934970.1.90084 WP_000934970.1.90220 WP_000934970.1.90293 WP_000934970.1.90521 WP_000934970.1.90792 WP_000934970.1.90876 WP_000934970.1.90878 WP_000934970.1.9089 WP_000934970.1.91023 WP_000934970.1.91042 WP_000934970.1.91049 WP_000934970.1.91381 WP_000934970.1.91473 WP_000934970.1.91702 WP_000934970.1.91914 WP_000934970.1.92039 WP_000934970.1.92068 WP_000934970.1.92149 WP_000934970.1.92270 WP_000934970.1.92375 WP_000934970.1.92399 WP_000934970.1.9253 WP_000934970.1.92659 WP_000934970.1.92836 WP_000934970.1.92843 WP_000934970.1.92875 WP_000934970.1.92883 WP_000934970.1.92939 WP_000934970.1.92988 WP_000934970.1.93604 WP_000934970.1.93648 WP_000934970.1.93671 WP_000934970.1.93767 WP_000934970.1.93837 WP_000934970.1.93956 WP_000934970.1.94056 WP_000934970.1.94070 WP_000934970.1.94167 WP_000934970.1.94383 WP_000934970.1.94557 WP_000934970.1.94588 WP_000934970.1.9463 WP_000934970.1.94722 WP_000934970.1.94862 WP_000934970.1.94971 WP_000934970.1.94986 WP_000934970.1.9503 WP_000934970.1.95094 WP_000934970.1.95235 WP_000934970.1.95465 WP_000934970.1.95803 WP_000934970.1.95805 WP_000934970.1.95901 WP_000934970.1.96045 WP_000934970.1.96190 WP_000934970.1.96206 WP_000934970.1.9627 WP_000934970.1.96404 WP_000934970.1.96533 WP_000934970.1.96590 WP_000934970.1.96640 WP_000934970.1.96662 WP_000934970.1.96721 WP_000934970.1.96761 WP_000934970.1.96917 WP_000934970.1.97005 WP_000934970.1.97496 WP_000934970.1.97534 WP_000934970.1.97628 WP_000934970.1.97693 WP_000934970.1.97768 WP_000934970.1.9811 WP_000934970.1.98392 WP_000934970.1.98483 WP_000934970.1.9887 WP_000934970.1.98931 WP_000934970.1.99083 WP_000934970.1.99198 WP_000934970.1.99219 WP_000934970.1.99255 WP_000934970.1.99327 WP_000934970.1.99370 WP_000934970.1.99637 gi|194736200|ref|YP_002117346.1| 439843.SeSA_A4675 ABAK02000001|CDS_3959468-3958125 ABEH02000001|CDS_235212-233869 ABEI01000013|CDS_13382-12039 ABEJ01000001|CDS_13130-11787 CP001127|CDS_4543964-4542621 gi|452121861|ref|YP_007472109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]