SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452123473|ref|YP_007473721.1| from Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452123473|ref|YP_007473721.1|
Domain Number 1 Region: 162-299
Classification Level Classification E-value
Superfamily CBS-domain pair 1.77e-21
Family CBS-domain pair 0.0041
Further Details:      
 
Domain Number 2 Region: 310-392
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.85e-21
Family CorC/HlyC domain-like 0.00012
Further Details:      
 
Weak hits

Sequence:  gi|452123473|ref|YP_007473721.1|
Domain Number - Region: 31-122
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0811
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452123473|ref|YP_007473721.1|
Sequence length 398
Comment hypothetical protein CFSAN001992_20045 [Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992]
Sequence
MTLNRYRLRHMAKQGNRSAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLYG
DAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQILMMPLVWLLNTIT
RLLMRLMGIKTDIVVSGSLSKEELRTIVHESRSQISRRNQDMLLSVLDLEKVSVDDIMVP
RNEIIGIDINDDWKSIERQLTHSPHGRIVLYRDSLDDAISMLRVREAWRLMAEKKEFTKE
MMLRAADEIYYVPEGTPLSTQLIKFQRNKKKVGLVVNEYGDIQGLVTVEDILEEIVGDFT
TSMSPTLAEEVTPQNDGSVIIDGTANVREINKAFNWHLPEDDARTVNGVILEALEEIPVA
GTRVRIEQYDIDILDVQENMIKQVKVVPVKPLRESILE
Download sequence
Identical sequences gi|452123473|ref|YP_007473721.1| 295319.SPA2538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]