SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119944085|ref|YP_941765.1| from Psychromonas ingrahamii 37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119944085|ref|YP_941765.1|
Domain Number 1 Region: 555-1007
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-123
Family ALDH-like 0.000000591
Further Details:      
 
Domain Number 2 Region: 183-526
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-113
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000748
Further Details:      
 
Domain Number 3 Region: 11-182
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 9.02e-60
Family N-terminal domain of bifunctional PutA protein 0.00000866
Further Details:      
 
Domain Number 4 Region: 1038-1192
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000000011
Family ALDH-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119944085|ref|YP_941765.1|
Sequence length 1264
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Psychromonas ingrahamii 37]
Sequence
MLFDGNLVADSTIRQKIRDFHRIDENLAVDHILPEAEVNMRARSRAWERARKMVLQIRRE
QEGTGVVEALLNEYSLSSAEGVVLMCLAEALLRVPDKKTQDELIRDKLSKGKWSTHLGTS
NSLFVNASSWGLLLTGSMVNFSDTRKSNQFGLLKKTLGRMGEPVIRKAMNIAMKVMGEQF
VIGETIVAAVKRAEQKERNGYVYSYDVLGEGARTEKDAERYFQSYVKALVVIGEAAKGRG
PRKSPGISVKLSAIHPRYEFSHRDRVLKELPQKLKSLCLLAKKYDIGLTVDAEESERLDI
SLDIIEIVFSDPELSDWDGFGLAVQAYQKRAIFVIDWLRELTEKVGRKMMVRLVKGAYWD
TEIKNAQKDGLEHYPVFTRKSSTDVSYHACANRLLDYRDTIYPQFATHNAYTASVIIELA
GDDKEGFEFQCLHGMGDSLYDQIVTTDNIQCRIYAPVGQHEDLLAYLVRRLLENGANSSF
VNAIVDETRPVESLLEDPVEKTQRLKVTYNEQILKPIDLFGKERDNSKGLDLNDINQITP
LRESLDRWFNDHLLTSDQVPDDCFAVKNPADHNEIIGFHRHDSREEMVAKLEKAHNSFAT
WSQTPIEERASLLRRTADILERHMDELIAICIKEAGKIAQDGIDEVREAVDFCRYYAARA
EELAEDDRLEPRGVVLCISPWNFPLAIFMGQVAAAIVTGNTVIAKPAEQTSLIALRALEL
MESVGMPEGTVTAVIARGPAVGEALLEDERIKAVVFTGSTTTGTHISRILANRGGDQIPL
IAETGGQNCMVVDSTALPEQVIDDVISSGFQSAGQRCSALRVLFLQEEIADGMTEMLIGA
LKELHIGDPAQLSTDVGPVIDSKALNSLEAHVKDMENKAELLYECPVPENNGTFFAPRLY
QIADISVLEREVFGPCVHIVRFKGDQLANTIEKINATGFGLTMGIHTRIEERAIELAKLS
RAGNVYINRNMIGAVVGVQPFGGTGLSGTGPKAGGPNYLSRFMNEKATPAPHQDDSVLGD
DKALISDKVSNLETLAFMKNAIKVEPEWRVTNLNDRISAVRQLLAQIAKVTIVEELADDF
NSTLAAARSQLISIEKKMRRPKALPGPTGESNVLYLEPRGILVCFADKNVTFEYWTLAIV
TALATGNTVISVVSDLFYEEALAFRDKFNATGAPEGVLQVAKLCHLEALLEQDKLAGVVI
DSHSPRRTFMVRKLAEREGAILPVITSEYTDHLIQRLLTEKSISIDITASGGNTSLMTLV
EEED
Download sequence
Identical sequences A1SRQ1
gi|119944085|ref|YP_941765.1| 357804.Ping_0300 WP_011768725.1.40834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]