SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119945035|ref|YP_942715.1| from Psychromonas ingrahamii 37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119945035|ref|YP_942715.1|
Domain Number 1 Region: 11-289
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.12e-22
Family Methylenetetrahydrofolate reductase 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119945035|ref|YP_942715.1|
Sequence length 318
Comment hypothetical protein Ping_1289 [Psychromonas ingrahamii 37]
Sequence
MSLTSLRNKSSDPKQGVYFIGTTPPKQDTAIELVSGIADKLLDRLDSIDYDGLIVYDIQD
ETSRIDKPRPFPFKYTHDSRLYSKILHDKSAKPVITYKSVSQRDGVDFSRWLSDAWHQFS
VRDIVLVGSPSANSDIKLSLADAYQTVKDHNLDFHLGGVAIAERHSNKGDEHLRMLAKNE
QGCEFFISQAVYNAQATIDMLTRYALECKKQGKKPRRVVLTFSPCGSAKTLAFIEWLGIS
VPEATSLRILESDNPLKESLLISRNNFEQILQACLPLDIPLGLNIESLTNRKEEIDAAIL
LFKLLKATLDLKLAESQL
Download sequence
Identical sequences A1SUF1
gi|119945035|ref|YP_942715.1| WP_011769679.1.40834 357804.Ping_1289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]