SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119945270|ref|YP_942950.1| from Psychromonas ingrahamii 37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119945270|ref|YP_942950.1|
Domain Number 1 Region: 557-1018
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-117
Family ALDH-like 0.000000938
Further Details:      
 
Domain Number 2 Region: 183-526
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.1e-108
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000105
Further Details:      
 
Domain Number 3 Region: 11-182
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.05e-59
Family N-terminal domain of bifunctional PutA protein 0.00000698
Further Details:      
 
Domain Number 4 Region: 1045-1223
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000327
Family ALDH-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119945270|ref|YP_942950.1|
Sequence length 1276
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Psychromonas ingrahamii 37]
Sequence
MLFNNSNITASPIRQKIREFYRIDESIAVEHILPLAEVNDNAASRAWEKARKMSMKIRKD
ESGNGAVDALLAEYTLSSEEGVVLMCLAEALLRVPDKHTQDALISDKISKGQWDSHLGSS
DSLFVNASSWGLLVTGKMVDYADEREKDSFDLLKKVIGRLGEPVIRKSMNYAMQIMGEQF
VMGETIQDATDHAAKKARQGFVYSYDMLGEGARTMSDAEKYFKAYQVAIDAIGAVARASG
KNDPRKVPGISVKLTAIHPRYEFAQKERVMAEVAPKLKALCLQAKSYNIGLTVDAEESER
LDISLDVIEAVFSDDELAGWNGFSMALQAYQKRAIFIVDWLRELTIRVDRKMMVRLVKGA
YWDTQIKNSQKGGYQHFPLFTRKASTDVSYIACAKKLLEYRDTIFPQFATHNAYTVATIL
ELAGNDKTSFEFQCLYGMGGSLYDQVVTNENVQCRIYAPVGPHEDLLAYLVRRLLENGAN
SSFVNAIIDDSQPIESLLRNPVEKMHSLKDKYNGQIIKPIALYHDQKGVGRDNSKGLDLT
DINTVTPLKTSLDNWLVNNLFSEDDVPEGSIAIRNPAKQSEIIGFQRHHSKDEMLAMVET
AHNAFASWSQTSVSERADLLCRVADVLEHHMDEFIALCIKEAGKTTQDGIDEVKEAVDFC
RYYAQQAIELAEDDRIEARGVVLCISPWNFPLAIFVGQVTAAIATGNTVLAKPAQQTSLI
ALRAIELMTSVGLPHGVVQAVIAKGSDVGKVIIPNARIQAVIFTGSIKTATIISQTLADR
GGDQVPFIAETGGQNCMLVDSTALPEQVVDDVISSGFQSAGQRCSALRVLFLQEDIADNV
ITMLKGALAELHVGNPEKLSTDVGPVIDQKALDSLNAHSDYMKTHGQLLYQCDISDEITN
EIADNEHFFFAPRLYEIENISALKEEVFGPCVHIVRFKGDEIEKVVDDINDTGFGLTMGI
HTRIEQRALKLAKLSRAGNVYINRNIIGAIVGVQPFGGRGLSGTGPKAGGPYYLTRLVKE
ITTPAAKKLNLIPQQAEASNSDTDAQAVLFMDKARTAEKIWRLTELNTRISCVSEVLAKI
AHIDIITNLADDLTNTLKAARSQLIDIEKHLKEPTVLPGPTGESNILYLENRGNIICFAD
ENVSFHFWLLSVVTALATGNTVISVVSDLFYDQAIAFRDELIATGEDENIFQIARLCHLT
TLLAQPGLSGVVVDSHCDREHYISEKLAERQGAILPVISSKYVDNLMQRLLTEKAVSINT
TATGGNTSLMTLDEED
Download sequence
Identical sequences A1SV36
gi|119945270|ref|YP_942950.1| WP_011769911.1.40834 357804.Ping_1543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]