SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119945268|ref|YP_942948.1| from Psychromonas ingrahamii 37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119945268|ref|YP_942948.1|
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.86e-24
Family Sfri0576-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119945268|ref|YP_942948.1|
Sequence length 124
Comment hypothetical protein Ping_1540 [Psychromonas ingrahamii 37]
Sequence
MINAKLMRNDGILIVEPVDKLEKKDFKQVALLVNPYLEKHAVLNGILIDAESFPGWENFA
GLVSHLRFINQYEKKVKRIAAVTDIGILSILPKIVKHFVSAEVRHFSYKERELALSWLQT
DGAG
Download sequence
Identical sequences A1SV34
WP_011769909.1.40834 gi|119945268|ref|YP_942948.1| 357804.Ping_1540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]