SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965244|ref|YP_001010325.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965244|ref|YP_001010325.1|
Domain Number 1 Region: 208-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-43
Family Nitrogenase iron protein-like 0.00000188
Further Details:      
 
Domain Number 2 Region: 108-178
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.00000000000000406
Family Domain of the SRP/SRP receptor G-proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965244|ref|YP_001010325.1|
Sequence length 415
Comment signal recognition particle docking protein FtsY [Prochlorococcus marinus str. MIT 9515]
Sequence
MTNNESDNAREWASQAYALLKQKQEEQKQEEQKQEEQKQQEQKQQEQKQQEQKQQEQKQE
EVYKQDFSNVKYETAAKLGEFDDEFTWSAMVLAAQGKKANEISIDEIDWLSKLRKGLEET
RKGFVTELLDKLGDDPLTPESLDDLETLLIRADVGIDSTDKVIDSLRKKLNEEVVGGEEG
IKFLKGELRAIIDKPIKDSGINILVPQKGKLNVWLIVGVNGVGKTTTLGKLAYLSSKSNY
KTLIAAADTFRAAAVEQLQVWGHRSKVEVISNQSKNADPAAVVFDALNAANKRNSDLLLV
DTAGRLQTKNNLMDELSKIKRIIDKKVPDAIVESLLVLDASQGQNGLKQAKSFAKSANLS
GAVITKLDGTSRGGVSLAVSAEVNLPIRFIGAGEGIKDLRPFNSFEFVEALLADR
Download sequence
Identical sequences A2BTW6
gi|123965244|ref|YP_001010325.1| 167542.P9515_00091 WP_011819335.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]