SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965287|ref|YP_001010368.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965287|ref|YP_001010368.1|
Domain Number 1 Region: 75-354
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.27e-63
Family Alanine racemase-like, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 469-576
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000241
Family Eukaryotic ODC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123965287|ref|YP_001010368.1|
Sequence length 648
Comment arginine decarboxylase [Prochlorococcus marinus str. MIT 9515]
Sequence
MTNFDSKKLNKHWTIEDSISTYGIDKWGDQYFSINSLGNISITPNRNSKKTIDLFKLVNE
IKSREINTPLILRFNDILKDRITELNNAFSQAIETYNYKNIFQGVFPIKCNQQKNVLEKI
IEYGDYWDFGLEVGSKSELLIGLSLLENKKSLLICNGYKDKKYIEIAILARKLGKQPIIV
IEQIDEVQRIIEAVKNLRSTPILGIRSKLSSKSSGRWGKSVGDNSKFGLSIPEIMLTIKE
LKEASLINEMKLLHFHIGSQISDISVIKDALQEASQIFVELSKLGAPMKYIDVGGGLGID
FDGTKTSSNTSTNYSLQNYANDVVATIKDSCEVNNIQHPIIISESGRAIVSHCSVLIFDV
LGTSHVSSQIKVSHQKKTSLIIKNLIDTHNQLKNLRNKKEDLSEIIELWNDAKKFKKDCL
VAFRLGFISLGERAYAEELTWACAKEISSHLDNEKIIHPDLSEITETLSSTYYANLSVFK
SIPDTWAINQIFPIIPIHRHLEEPICKGNFADLTCDSDGKLNNFIDNGKIKSLLNLHRPE
ENNDYLIGIFMAGAYQEALGNFHNLFGNTNVIHIDINEDNTYKIKNIIKENSKSEILELL
DYSSDNLVESIRINTEFAINNKTLSIEEARKLIDQIETSLRKSSYLSE
Download sequence
Identical sequences A2BU00
gi|123965287|ref|YP_001010368.1| WP_011819378.1.83733 167542.P9515_00521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]