SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123965427|ref|YP_001010508.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965427|ref|YP_001010508.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000562
Family Single-domain sulfurtransferase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965427|ref|YP_001010508.1|
Sequence length 116
Comment rhodanese-like protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MRNYPKIINALDLNKWFNSEDENPIIIDVRENSELEIACFPREFLHLPISKISLDYVKTK
ISNVKDKKFVVLCHAGIRSYNFGQWSLDNNLVNEIWNLEEGIDGWSRYIDQTIPRY
Download sequence
Identical sequences A2BUE0
167542.P9515_01921 gi|123965427|ref|YP_001010508.1| WP_011819515.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]