SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965442|ref|YP_001010523.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965442|ref|YP_001010523.1|
Domain Number 1 Region: 118-305
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.61e-48
Family ATP-binding domain of peptide synthetases 0.0000661
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.91e-35
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123965442|ref|YP_001010523.1|
Sequence length 307
Comment glutathione synthetase [Prochlorococcus marinus str. MIT 9515]
Sequence
MKFLFVVDPIKNINPLKDSSAALMQASSKKKIKVWTCTPQDLEARGDEVWASSFRAEVIP
WVSFKENKCIPLAEFNCIWMRKDPPVNEGYLYATHLLEVAERKGVKVINKPSSLRAWNEK
LGALRYSHLMAPTIVASKVKDLINFAQINDDVVVKPLGGKGGQGVIRLNKDSPGIKAMIE
LITSQEELPVMMQKFIPEVNKGDKRIIIVNGEPIGSINRIPQGGDFRSNLAMGGKAEKTN
LTAKEKKICTELSQHFKDEGLFFVGIDVINEMLSEINVTSPTGLREIENLSNKKVSDQVI
EKLLEII
Download sequence
Identical sequences A2BUF5
WP_011819530.1.83733 gi|123965442|ref|YP_001010523.1| 167542.P9515_02071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]