SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965452|ref|YP_001010533.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965452|ref|YP_001010533.1|
Domain Number 1 Region: 109-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.06e-48
Family NadC C-terminal domain-like 0.000035
Further Details:      
 
Domain Number 2 Region: 3-108
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.98e-25
Family NadC N-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123965452|ref|YP_001010533.1|
Sequence length 288
Comment nicotinate-nucleotide pyrophosphorylase:quinolinate phosphoriobsyl transferase [Prochlorococcus marinus str. MIT 9515]
Sequence
MDFYSPNISRIIDYWIEEDIGKGDLTSSAITENIGKAHWLAKEKGIFCGVEIIKTILNKI
DENIDCRFFIKDGETFLKDQKLLELCGPSRSLLASERISLNISMHLSGISTYTKNIVDVL
KGTNIKLADTRKTTPGLRIFEKYAFKCGGGINHRMGLYDAAMIKENHIAWTDNLNNAVKK
IRLNTPFTTHIIIEAENMKQAKDAVLAGADSILLDEFNPELLEKCIKELRELSINSSKRT
KRNNLIIEVSGINPRDISNYLIDGVDFISTSSSITKSNWIDFSMRYIN
Download sequence
Identical sequences A2BUG5
gi|123965452|ref|YP_001010533.1| 167542.P9515_02171 WP_011819540.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]