SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965469|ref|YP_001010550.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965469|ref|YP_001010550.1|
Domain Number 1 Region: 20-140
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.96e-29
Family N-utilization substance G protein NusG, N-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 131-201
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000000191
Family N-utilization substance G protein NusG, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965469|ref|YP_001010550.1|
Sequence length 203
Comment transcription antitermination protein NusG [Prochlorococcus marinus str. MIT 9515]
Sequence
MSNELTANLGSQKANTSIARWYAVQVASSCEKKVKATLEQRSVTLGVNNRIIEIEIPQTP
GIKLKKDGSRQTTEEKVFPGYVLVRMILDEDTMMAVKSTPNVINFVGAEDGRGSGRSRGH
IKPRPLSRQEVNRIFKRASEKKAVIKLDLEEKDRIIVTSGPFKDFQGEVIEVSGERNKLK
ALLSIFGRETPVELEFSQINKQN
Download sequence
Identical sequences A2BUI2
WP_011819557.1.83733 gi|123965469|ref|YP_001010550.1| 167542.P9515_02341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]