SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965482|ref|YP_001010563.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965482|ref|YP_001010563.1|
Domain Number 1 Region: 303-534
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-33
Family ABC transporter ATPase domain-like 0.00071
Further Details:      
 
Domain Number 2 Region: 86-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000209
Family DNA repair protein MutS, domain III 0.025
Further Details:      
 
Domain Number 3 Region: 730-802
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000144
Family Smr domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123965482|ref|YP_001010563.1|
Sequence length 803
Comment DNA mismatch repair protein MutS family protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MKEKSHYKNLLSHKSLSEESIGLLEWDTLKTQIASFASTKMGKNVVLQFEIPTEYEISRR
LLKETIEINELEKNLDKSISFSGVFDICKNIEICSKGGVINSSDLLEIAETISASRNLKK
ILLDFEQRPFISAFLKGLIDHNQIEKILKNGIESNGRISDRASQKLANLRQELLSKKSER
RVLVNKFIQNNLPYIQDTIVGDRYGRPVLAIKVQYAEKFKGIIHDSSASGNTIYLEPESI
VLKGNKIASMEARVAGEEFKLLKEWSHIIRDNNQSLLEMSNILLRAEFSLTRSRYSNWIG
GNAPIVENSPIVSLMGFSHPLLIWENKKKQAAKPVSIDFHIDRNTKVVAITGPNTGGKTV
ALKGLGIALLMARSGLFIPSIQKPIIPFCPNIFVDIGDDQSLEGNLSTFSGHILRIKNIL
EALNNKKGFSVVLLDEIGSGTDPSEGTALAIALLKEFAIVSDITLATTHYGDIKALKYSD
NRFENVSVAFDEESFKPKYTLNWGIPGRSNALSISKRIGINEKILNNASNYLKPKEVENI
NNIIKGLEEERLKQQKSAEEAAELIARTEILHDEIKNKYEFQKLNALKIQEAEKQKLSKH
IKEAQKEVINLIKKLKDQNATGEDARLIGIRLKEIETDHLTQSNVERTTSWSPKIGDFIK
IKSLNSSGQIIDIDEKAKSYEVKCGSFRSTLSINDFEGLNGEKPKFKDSQIQISSVREDF
SFSKIRTSKNTIDVRGMRVHEAEIIIEEKFKKFHGPLWIVHGIGTGKLKKGLRLWLSSLN
YVDKVEDAENNEGGAGCSIAWIK
Download sequence
Identical sequences A2BUJ5
gi|123965482|ref|YP_001010563.1| 167542.P9515_02471 WP_011819570.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]