SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965525|ref|YP_001010606.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965525|ref|YP_001010606.1|
Domain Number 1 Region: 265-428
Classification Level Classification E-value
Superfamily CinA-like 6.54e-49
Family CinA-like 0.0000949
Further Details:      
 
Domain Number 2 Region: 17-217
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.09e-34
Family MoeA central domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965525|ref|YP_001010606.1|
Sequence length 433
Comment molybdenum cofactor biosynthesis protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MKPNLNHRSNEPNCKGVEILSIGTELLLGNIVNTNAQWISEELSALGLNHFRQSTIGDNS
KRISNLIKEISLRSDLLITTGGLGPTPDDLTTEAIAKSFNVTLYERESLWDEIKKKLSLS
SSIQNNSSLKKQCFFPKDAQIIHNPRGTAPGMIWKPKKGFTILTFPGVPSEMKVMWKETA
IDYIQKNFSDGYIFFSNTLNFSGIGESKVSEKIDNLLKLKNPTVAPYANLGELKLRITAR
ATNELQAKNLIKPVKEELKKEFSKFIFGEDNETLSSVLIKELLKRKESLGFAESCTGGLL
SSTITKVSGSSQVFKGSIISYSNELKQSLLNIPEDRIKKYGAVSEEIAQDMTINAREKLN
SDWSIAISGIAGPSGGSKEKPVGIVYISIAGPNNHITNIKKIFSSTRNRVEIQRLSVNVC
LNSLRLILLSKSK
Download sequence
Identical sequences A2BUN8
WP_011819609.1.83733 167542.P9515_02901 gi|123965525|ref|YP_001010606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]